Align Imidazole glycerol phosphate synthase subunit HisF; EC 4.3.2.10; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF (uncharacterized)
to candidate WP_036260739.1 DL86_RS09690 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
Query= curated2:Q67KI0 (254 letters) >NCBI__GCF_000746085.1:WP_036260739.1 Length = 246 Score = 107 bits (267), Expect = 2e-28 Identities = 71/233 (30%), Positives = 120/233 (51%), Gaps = 10/233 (4%) Query: 7 IIPCLDIRDGRVVKNVQFHLN--TWDAGDPVALAAEYDRQGADEIVFLDINASWEGRSAT 64 + P +D+++GR V+ Q + T DP A A ++RQG + + +D++ ++ GR Sbjct: 3 LFPAIDLKEGRCVRLQQGDMAKATIFNEDPAAQAQAFERQGFEYLHVVDLDGAFAGRPMN 62 Query: 65 LDVLSRAAEQVFVPLTIGGGVSAVEHVKAYLRAGADKVSVNTAAVQRPDLIDEIADLFGS 124 + +V +P+ +GGG+ + ++A+L G +V + TAAV+ PDL+ + A L+ Sbjct: 63 AKAVEAILAKVKMPVQLGGGIRDLATIEAWLGKGVARVIIGTAAVRDPDLVRQAAKLY-P 121 Query: 125 STLVVAIDCKRRPEGGWEVYLHGGRTPTGIDAVAWAEEAARRGAGELLVTSMDADGTRQG 184 + V ID K +G V + G + + AV + G ++ T + DG QG Sbjct: 122 GAIAVGIDAK---DGA--VAVEGWAKTSALGAVELGKRFEDAGVAAIIYTDIARDGVLQG 176 Query: 185 YDIALHQALADAVGVPVIASGGAGSPEDILEVL--TVGRADAALAASIFHSGR 235 +IA ALADA+ +PVIASGG S +DI +L + A+ + GR Sbjct: 177 LNIAATLALADALAIPVIASGGLASLDDIERLLQPDCAKLAGAITGRALYDGR 229 Lambda K H 0.319 0.136 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 246 Length adjustment: 24 Effective length of query: 230 Effective length of database: 222 Effective search space: 51060 Effective search space used: 51060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory