Align alanine—glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate WP_036261431.1 DL86_RS11215 pyridoxal phosphate-dependent aminotransferase
Query= metacyc::MONOMER-21143 (387 letters) >NCBI__GCF_000746085.1:WP_036261431.1 Length = 400 Score = 205 bits (522), Expect = 2e-57 Identities = 126/393 (32%), Positives = 196/393 (49%), Gaps = 13/393 (3%) Query: 3 LAKNLQRLGTESAFSVLAEAKKLEAQGKPMIHLGLGQPDFKTPQHVVDAAKKALDEGHHG 62 +A L R+ + +V +A+ L+ G+ +I L +G+PDF TP ++ AA A++ G Sbjct: 4 IADALLRVKPSATIAVTQKARDLKNAGRDIISLSVGEPDFDTPDNIKKAAIAAIERGETK 63 Query: 63 YVLSNGILECRQAVTRKIKKLYNKDIDPERVLIMPGGKPTMYYAIQCFGEPGAEIIHPTP 122 Y GI R+A+ +K K+ D + ++ GGK ++ A PG E++ P P Sbjct: 64 YTPVAGIPPLREAIAQKFKRENGIDYKASQTIVGTGGKHILFNAFLATINPGDEVVIPAP 123 Query: 123 AFPIYESMINYTGSTPVPYDLTEDKDLKFDPEKILSLITDKTRLLILINPNNPTGSFVEK 182 + Y M+ G TPVP + + K PE + IT KT+ L+L +P NP+G+ Sbjct: 124 YWVSYPDMVLLAGGTPVPVETKIENGFKLQPEALEKAITPKTKWLLLNSPANPSGAAYAS 183 Query: 183 SAIDVLAEGLKKHPHVAILSDEIYSRQIYDGKEMPTFFNY-PDLQDRLIVLDGWSKAYAM 241 + + L + L +H V +L+D+IY IY T PDL DR + ++G SK+YAM Sbjct: 184 AELKALTDVLLRHEQVWVLTDDIYEHLIYGDFTFATPAQVEPDLIDRTLTMNGVSKSYAM 243 Query: 242 TGWRMGWSVWPEELIPHVNKLIINSVSCVNAPSQFAGIAALDGPDDAIHEMMVKFDQRRK 301 TGWR+G++ PE LI + L S + +Q+A + AL GP D I E F++RR Sbjct: 244 TGWRIGYAAGPEFLIKAMEMLQGQQTSGACSIAQWASVEALTGPQDFIAERRKIFEERRN 303 Query: 302 LIHEGLNSLPGVECSLPGGAFYAFPKVIGT----------GMNGSEFAKKCMHEAGVAIV 351 L+ L+ + C P GAFY +P T + +F + GVA+V Sbjct: 304 LVVSMLSQAKYLHCPTPEGAFYVYPSCAETIGKRTPDGNLIASDEDFVAALLDAEGVAVV 363 Query: 352 PGTAFGKTCQDYVRFSYAASQDNISNALENIKK 384 G+AFG R SYA + + A I++ Sbjct: 364 QGSAFG--LGPNFRISYATATSVLEKACAKIQR 394 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 400 Length adjustment: 31 Effective length of query: 356 Effective length of database: 369 Effective search space: 131364 Effective search space used: 131364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory