Align Ribose-phosphate pyrophosphokinase; RPPK; EC 2.7.6.1; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase (uncharacterized)
to candidate WP_036263710.1 DL86_RS16755 ribose-phosphate pyrophosphokinase
Query= curated2:Q83YI7 (318 letters) >NCBI__GCF_000746085.1:WP_036263710.1 Length = 323 Score = 179 bits (454), Expect = 8e-50 Identities = 117/327 (35%), Positives = 179/327 (54%), Gaps = 23/327 (7%) Query: 10 LKIFSLNSNRELAEEIAKEVGIELGKSSVTHFSDGEIQINIEESIRGCHVYVIQST---- 65 +++F+LN++R AE+IA +G+EL F DGE + S+RG VYV+QS Sbjct: 1 MQLFTLNASRTFAEKIAAALGVELSSHEEREFEDGEHKARPLASVRGEDVYVVQSLHGGP 60 Query: 66 SNPVNQNLMELLIMIDALKRASAATINIVMPYYGYARQDRKARSREPITAKLVANLIETA 125 N L LL + +K AA + V+PY YAR+DR+ + R+P+T + VA L+E A Sbjct: 61 DQSPNDKLCRLLFFLATMKENGAARVTAVIPYLAYARKDRQTKPRDPVTTRYVAELLEAA 120 Query: 126 GATRMITLDMH-APQIQGFFDIPIDHLNAVRLLSNYFGERHLG----DDLVVVSPDHGGV 180 GA ++TLD+H Q F HL+ RL F ER + VV SPD GGV Sbjct: 121 GADCVVTLDVHNIVAFQNAFRCETIHLDTRRL----FAERAVALIGEAAAVVASPDPGGV 176 Query: 181 TRARKMADRLKAPI------AIIDKRRPRPNVAEVMNIVGNVEGKVCIIIDDIIDTAGTI 234 RA+ + L+ + A ++KRR V+ + +VG+V G +I+DD+I GT+ Sbjct: 177 KRAQLFREMLETMLGRPVGSAFMEKRRSAGVVSGNL-LVGDVAGATVLIVDDLISGGGTM 235 Query: 235 TLAAKALREAGATKVYACCSHPVLSGPAMKRIEESPIEKLVVTNSIA--LPEDKWI-DKM 291 A+ A RE GA +YA +H + +G A + S + K VT+++ +DK + ++ Sbjct: 236 ARASHACREGGAKTIYAFAAHGLFTGEAASALRHSDLAKTFVTDTVPPFRLDDKLVGGRV 295 Query: 292 EQLSVAPLLGEAIVRVHENASVSSLFE 318 E LS APL +AI +HE+ S+++L E Sbjct: 296 EILSAAPLFAKAIRALHEDGSINALLE 322 Lambda K H 0.319 0.135 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 323 Length adjustment: 28 Effective length of query: 290 Effective length of database: 295 Effective search space: 85550 Effective search space used: 85550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_036263710.1 DL86_RS16755 (ribose-phosphate pyrophosphokinase)
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01251.hmm # target sequence database: /tmp/gapView.19431.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01251 [M=309] Accession: TIGR01251 Description: ribP_PPkin: ribose-phosphate diphosphokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-80 254.7 0.0 5.3e-80 254.6 0.0 1.0 1 lcl|NCBI__GCF_000746085.1:WP_036263710.1 DL86_RS16755 ribose-phosphate py Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000746085.1:WP_036263710.1 DL86_RS16755 ribose-phosphate pyrophosphokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 254.6 0.0 5.3e-80 5.3e-80 1 308 [. 1 321 [. 1 322 [. 0.92 Alignments for each domain: == domain 1 score: 254.6 bits; conditional E-value: 5.3e-80 TIGR01251 1 lkilsgssskelaekvaknlglelgdvevkkFadgElyvrieesvrgkdvfiivqsts....apvndal 65 ++++ +++s+++aek+a +lg+el + e ++F dgE + r svrg+dv+++ qs + ++ nd+l lcl|NCBI__GCF_000746085.1:WP_036263710.1 1 MQLFTLNASRTFAEKIAAALGVELSSHEEREFEDGEHKARPLASVRGEDVYVV-QSLHggpdQSPNDKL 68 67899************************************************.55542333578**** PP TIGR01251 66 mellllidalkrasaksvtaviPyygYaRqdkkaksrepisaklvaklleeaGadrvltvdlHs.eqiq 133 ll+ + ++k+++a +vtaviPy++YaR+d+++k+r+p++ + va+lle+aGad v+t+d+H+ + q lcl|NCBI__GCF_000746085.1:WP_036263710.1 69 CRLLFFLATMKENGAARVTAVIPYLAYARKDRQTKPRDPVTTRYVAELLEAAGADCVVTLDVHNiVAFQ 137 ***************************************************************94578* PP TIGR01251 134 gfFdvpvenlsaspklieelkkke.lknlvvvsPDkGaverakkvakklglel......aiieKeRdsk 195 ++F+ + +l++ + ++e+ + + vv sPD G+v+ra+ +++ l++ l a++eK+R + lcl|NCBI__GCF_000746085.1:WP_036263710.1 138 NAFRCETIHLDTRRLFAERAVALIgEAAAVVASPDPGGVKRAQLFREMLETMLgrpvgsAFMEKRRS-A 205 **********************99899999***************9998865433334499*****9.5 PP TIGR01251 196 enevevtnllgdvegkdvvivDDiisTggTlvkaaelLkekGAkkvivaathgvfsgdAlerlaeagve 264 +v+ + l+gdv+g +v+ivDD+is ggT+++a+++ +e GAk +++ a hg+f+g+A++ l+++ + lcl|NCBI__GCF_000746085.1:WP_036263710.1 206 G-VVSGNLLVGDVAGATVLIVDDLISGGGTMARASHACREGGAKTIYAFAAHGLFTGEAASALRHSDLA 273 5.9****************************************************************** PP TIGR01251 265 evivtntilv...ee.kklpkvseisvapliaeaiarihenesvsslf 308 + +vt+t++ ++ +v+ +s apl+a+ai++ he+ s+++l+ lcl|NCBI__GCF_000746085.1:WP_036263710.1 274 KTFVTDTVPPfrlDDkLVGGRVEILSAAPLFAKAIRALHEDGSINALL 321 ********9753333345689************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (323 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.34 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory