Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate WP_037060439.1 BLS63_RS10000 aldolase
Query= BRENDA::A5F699 (292 letters) >NCBI__GCF_900100495.1:WP_037060439.1 Length = 334 Score = 64.7 bits (156), Expect = 3e-15 Identities = 48/159 (30%), Positives = 71/159 (44%), Gaps = 8/159 (5%) Query: 11 TPFTPDGE-------VDYISLKKLVDFHVDAGTDAIVSVGTTGESATLTVEEHVKVVAKT 63 TP TPD VD ++V+ + AG + I+S+GT GE ATLT EE V+ Sbjct: 25 TPATPDASNWRSTNTVDLNETARIVEELIAAGVNGILSMGTFGECATLTWEEKRDYVSTV 84 Query: 64 VEFAEGRLPIIAGTGANATHEAVTFSRLLNNTGIAGYLSVTPYYNKPTQEGLFLHYNAIA 123 VE GR+P GT A T E + +R + G +G + P + K Y +A Sbjct: 85 VETIRGRVPYFCGTTALNTREVIRQTREFMDMGASGTMLGVPMWVKMDLPTAVQFYRDVA 144 Query: 124 QET-DIPVILYNVPGRTAVDMRPETVARLSEIKNIVALK 161 + + + +Y P D A +S+I +V K Sbjct: 145 EAVPEAAIAIYANPEAFKFDFPRPFWAEMSKIPQVVTAK 183 Lambda K H 0.318 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 334 Length adjustment: 27 Effective length of query: 265 Effective length of database: 307 Effective search space: 81355 Effective search space used: 81355 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory