Align Acetylornithine deacetylase; AO; Acetylornithinase; N-acetylornithinase; NAO; EC 3.5.1.16 (characterized)
to candidate WP_037374548.1 A3GO_RS0102105 acetylornithine deacetylase
Query= SwissProt::P23908 (383 letters) >NCBI__GCF_000428045.1:WP_037374548.1 Length = 381 Score = 369 bits (946), Expect = e-106 Identities = 190/377 (50%), Positives = 248/377 (65%), Gaps = 1/377 (0%) Query: 6 PPFIEIYRALIATPSISATEEALDQSNADLITLLADWFKDLGFNVEVQPVPGTRNKFNML 65 P I + LIA PS+S+ DQSN +I LADW + GF VEV P+PG +KFN++ Sbjct: 4 PALIPMIEQLIAAPSVSSISPQWDQSNEQVIQHLADWCRSAGFQVEVLPIPGHASKFNLV 63 Query: 66 ASIGQGAGGLLLAGHTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALR 125 AS G+G GGL+L+GHTDTVP+D+ RW DPF L E D +LYGLGT+DMK FFA +L+A+R Sbjct: 64 ASAGKGPGGLVLSGHTDTVPYDEQRWQSDPFRLVERDNRLYGLGTSDMKAFFALVLEAVR 123 Query: 126 DVDVTKLKKPLYILATADEETSMAGARYFAETTALRPDCAIIGEPTSLQPVRAHKGHISN 185 +D+++LK+PL +LATADEE++M GA+ ET A+IGEPT L+PVR HKG Sbjct: 124 GLDLSQLKQPLTLLATADEESNMCGAQSLLETNRRLGRYAVIGEPTGLKPVRMHKGISME 183 Query: 186 AIRIQGQSGHSSDPARGVNAIELMHDAIGHILQLRDNLKERYHYEAFTVPYPTLNLGHIH 245 IR+ G+SGHSS+PA GVNA+E M+ IG IL RD L+ R+ F V PTLNLGHIH Sbjct: 184 IIRLHGRSGHSSNPALGVNALEGMYRVIGDILAWRDELQARHKNPLFEVEVPTLNLGHIH 243 Query: 246 GGDASNRICACCELHMDIRPLPGMTLNELNGLLNDALAPVSERWPGRLTVDELHPPIPGY 305 GGD NRICA CEL +D+RPLPGM L +L+ L L + RL + P IP Sbjct: 244 GGDNPNRICASCELQIDLRPLPGMVLQDLHDELAQRLERLMSGSELRLEIITPFPGIPSM 303 Query: 306 ECPPNHQLVEVVEKLLGAKTEVVNYCTEAPFIQTL-CPTLVLGPGSINQAHQPDEYLETR 364 E + ++V E+L G V + TEAP++Q L TL+LGPG I+QAHQP+E++ Sbjct: 304 ETAADSEIVRTAEQLTGHTASSVAFGTEAPYLQQLGMETLILGPGDIDQAHQPNEFIGLE 363 Query: 365 FIKPTRELITQVIHHFC 381 I+P L+ +I FC Sbjct: 364 RIQPMVGLLQGLIRSFC 380 Lambda K H 0.320 0.139 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 448 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 381 Length adjustment: 30 Effective length of query: 353 Effective length of database: 351 Effective search space: 123903 Effective search space used: 123903 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate WP_037374548.1 A3GO_RS0102105 (acetylornithine deacetylase)
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01892.hmm # target sequence database: /tmp/gapView.3691727.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01892 [M=365] Accession: TIGR01892 Description: AcOrn-deacetyl: acetylornithine deacetylase (ArgE) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-126 407.1 0.0 3.9e-126 406.9 0.0 1.0 1 NCBI__GCF_000428045.1:WP_037374548.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000428045.1:WP_037374548.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 406.9 0.0 3.9e-126 3.9e-126 3 362 .. 10 373 .. 8 376 .. 0.96 Alignments for each domain: == domain 1 score: 406.9 bits; conditional E-value: 3.9e-126 TIGR01892 3 lakLvafdsvsar......snvdlieyvedyleelgvavevlpvadgaeksnllaviGpkegagglvlsGhtD 69 +++L+a +svs sn ++i++++d+ +++g++vevlp ++ a k+nl+a+ G +g gglvlsGhtD NCBI__GCF_000428045.1:WP_037374548.1 10 IEQLIAAPSVSSIspqwdqSNEQVIQHLADWCRSAGFQVEVLPIPGHASKFNLVASAG--KGPGGLVLSGHTD 80 5789******998899999***************************************..999********** PP TIGR01892 70 vvPvdeaaWtsDpfrLtekdgrLYgrGtaDmkGFlalvLaavpdlaaakLkkPlhlvlsaDeevglaGakkli 142 +vP+de++W sDpfrL e+d+rLYg+Gt+Dmk F+alvL+av+ l+ +Lk+Pl l+++aDee + Ga++l+ NCBI__GCF_000428045.1:WP_037374548.1 81 TVPYDEQRWQSDPFRLVERDNRLYGLGTSDMKAFFALVLEAVRGLDLSQLKQPLTLLATADEESNMCGAQSLL 153 ************************************************************************* PP TIGR01892 143 ealarrpalaivGePtslvavRahkGkasakvtvrGreghssrpdrGvsaielaakllarlvaladklkredl 215 e+ r + a++GePt+l++vR hkG+ ++++Gr+ghss+p+ Gv+a e + ++++ ++a +d+l+ ++ NCBI__GCF_000428045.1:WP_037374548.1 154 ETNRRLGRYAVIGEPTGLKPVRMHKGISMEIIRLHGRSGHSSNPALGVNALEGMYRVIGDILAWRDELQARHK 226 ************************************************************************* PP TIGR01892 216 eeaFtppyatlniGtvkGGkavniiaaaCelvlelRpipGmdpeellallekiaeevkekapgfevkveelsa 288 + F+++ +tln+G+++GG+ n+i+a+Cel+++lRp+pGm +++l +l + +e + + + + NCBI__GCF_000428045.1:WP_037374548.1 227 NPLFEVEVPTLNLGHIHGGDNPNRICASCELQIDLRPLPGMVLQDLHDELAQRLERLMSGSELRLEIITPFPG 299 ***************************************************9999986666666666777888 PP TIGR01892 289 tpaleleedaelvalleklaGaaaevvsygteagllqelGieavvlGPGdidqahqpdeYveieelkrcrall 361 +p++e+ +d+e+v+ +e+l+G++a v++gtea++lq+lG+e+++lGPGdidqahqp+e++ +e +++ ll NCBI__GCF_000428045.1:WP_037374548.1 300 IPSMETAADSEIVRTAEQLTGHTASSVAFGTEAPYLQQLGMETLILGPGDIDQAHQPNEFIGLERIQPMVGLL 372 9999**************************************************************9988777 PP TIGR01892 362 e 362 + NCBI__GCF_000428045.1:WP_037374548.1 373 Q 373 6 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (381 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 28.46 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory