Align Carbamoyl-phosphate synthase small chain; Carbamoyl-phosphate synthetase glutamine chain; EC 6.3.5.5 (characterized)
to candidate WP_038018886.1 G579_RS0107820 carbamoyl-phosphate synthase small subunit
Query= SwissProt::P0A6F1 (382 letters) >NCBI__GCF_000423825.1:WP_038018886.1 Length = 385 Score = 522 bits (1344), Expect = e-153 Identities = 254/380 (66%), Positives = 303/380 (79%), Gaps = 2/380 (0%) Query: 5 ALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVG 64 ALL LEDGT F G IG+ G AVGE+ FNT+MTGYQEILTDPSY+RQIVTLTYPHIGNVG Sbjct: 3 ALLALEDGTLFWGEGIGSQGQAVGELCFNTAMTGYQEILTDPSYARQIVTLTYPHIGNVG 62 Query: 65 TNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLRE 124 TN AD ES V+A GLVIRDLP ASN+R+ + L YLK + +VAIA IDTR+LTRLLRE Sbjct: 63 TNRADAESGAVYAAGLVIRDLPRRASNWRSEQTLERYLKDNRVVAIAGIDTRQLTRLLRE 122 Query: 125 KGAQNGCIIAGDNPDAALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEA 184 KGAQN ++ G++ DA AL AR FPGL+GMDLAK V+ Y W QGSWTL GGLP A Sbjct: 123 KGAQNAALVCGEHIDAEAALAAARNFPGLDGMDLAKVVSEPAPYEWAQGSWTLAGGLPHA 182 Query: 185 KK--EDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGP 242 +++LP HVVAYDFG KRNILRMLVDRGCR+T+VPA+T A +VL ++PDG+FLSNGP Sbjct: 183 PHPLDEKLPRHVVAYDFGIKRNILRMLVDRGCRVTVVPAETPAREVLALDPDGVFLSNGP 242 Query: 243 GDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVKDVEK 302 GDPAP DYA A ++ LE +P++GICLGHQLL LA GAK++KMKFGHHG NHPVKD++ Sbjct: 243 GDPAPMDYAQQATREILEQGVPLYGICLGHQLLCLALGAKSLKMKFGHHGANHPVKDLDS 302 Query: 303 NVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASPGPHD 362 V I++QNHGFA+D TLPA LRV+H SLFDG+LQG+ T+ PAFSFQGHPEASPGPH+ Sbjct: 303 GRVFISSQNHGFAIDAETLPATLRVSHVSLFDGSLQGVAHTELPAFSFQGHPEASPGPHE 362 Query: 363 AAPLFDHFIELIEQYRKTAK 382 LFD F++ I+ YRK+ + Sbjct: 363 MGYLFDRFVDQIDAYRKSRR 382 Lambda K H 0.318 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 527 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 385 Length adjustment: 30 Effective length of query: 352 Effective length of database: 355 Effective search space: 124960 Effective search space used: 124960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_038018886.1 G579_RS0107820 (carbamoyl-phosphate synthase small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.14831.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-144 467.2 0.0 1.9e-144 467.0 0.0 1.0 1 lcl|NCBI__GCF_000423825.1:WP_038018886.1 G579_RS0107820 carbamoyl-phospha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000423825.1:WP_038018886.1 G579_RS0107820 carbamoyl-phosphate synthase small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 467.0 0.0 1.9e-144 1.9e-144 1 360 [. 3 375 .. 3 376 .. 0.95 Alignments for each domain: == domain 1 score: 467.0 bits; conditional E-value: 1.9e-144 TIGR01368 1 atlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaesk 69 a l+ledGt f g+++g+++++vGe++FnT+mtGYqEiltDpsY++qiv+ltyp+ign+g+n+ daes lcl|NCBI__GCF_000423825.1:WP_038018886.1 3 ALLALEDGTLFWGEGIGSQGQAVGELCFNTAMTGYQEILTDPSYARQIVTLTYPHIGNVGTNRADAESG 71 579****************************************************************** PP TIGR01368 70 kikvkglvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavist.eksekee 137 ++++glv+++l +++sn+r++++Le++lk++ +vai+g+DTR+l++ lRekg+++a+++ e++++e lcl|NCBI__GCF_000423825.1:WP_038018886.1 72 AVYAAGLVIRDLPRRASNWRSEQTLERYLKDNRVVAIAGIDTRQLTRLLREKGAQNAALVCgEHIDAEA 140 *******************************************************99877615667889 PP TIGR01368 138 lvekakespkvkevnlvkevstkeayeleq..........k..akkegkk.lrvvvidlGvKenilreL 193 + ++a++ p +++++l+k vs +ye+ q + + ++k ++vv++d+G+K+nilr+L lcl|NCBI__GCF_000423825.1:WP_038018886.1 141 ALAAARNFPGLDGMDLAKVVSEPAPYEWAQgswtlagglpHapHPLDEKLpRHVVAYDFGIKRNILRML 209 9999*************************988877766651554445555689**************** PP TIGR01368 194 vkrgvevtvvpadtsaeeikklnpdgillsnGPGdPaaveeaietvkklleakiPifGIclGhqllala 262 v+rg++vtvvpa+t+a+e+ +l+pdg++lsnGPGdPa +++a + ++++le+ +P++GIclGhqll+la lcl|NCBI__GCF_000423825.1:WP_038018886.1 210 VDRGCRVTVVPAETPAREVLALDPDGVFLSNGPGDPAPMDYAQQATREILEQGVPLYGICLGHQLLCLA 278 ********************************************************************* PP TIGR01368 263 lgaktyklkfGhrGaNhpvkdlktgrveitsqNHgyavdeeslkeeelevthvnlnDgtveglehkelp 331 lgak +k+kfGh+GaNhpvkdl++grv+i+sqNHg+a+d e+l+++ l+v hv+l+Dg+++g++h+elp lcl|NCBI__GCF_000423825.1:WP_038018886.1 279 LGAKSLKMKFGHHGANHPVKDLDSGRVFISSQNHGFAIDAETLPAT-LRVSHVSLFDGSLQGVAHTELP 346 ******************************************8866.********************** PP TIGR01368 332 vfsvQyHPeaspGphdteylFdefvelik 360 +fs Q HPeaspGph+ ylFd+fv++i+ lcl|NCBI__GCF_000423825.1:WP_038018886.1 347 AFSFQGHPEASPGPHEMGYLFDRFVDQID 375 *************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (385 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 6.64 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory