Align Putative [LysW]-aminoadipate/[LysW]-glutamate kinase; EC 2.7.2.17; EC 2.7.2.19 (uncharacterized)
to candidate WP_038125948.1 N746_RS0109530 acetylglutamate kinase
Query= curated2:A8AA51 (264 letters) >NCBI__GCF_000711195.1:WP_038125948.1 Length = 304 Score = 124 bits (310), Expect = 3e-33 Identities = 88/258 (34%), Positives = 140/258 (54%), Gaps = 22/258 (8%) Query: 2 IVVKAGGRTLLNNMDEIVKSISR---LEKAV-----FVHGGGDLVDEWERKMGMEPQFKV 53 IVVK GG + D+++ S +R L K V VHGGG + + +++G E +F Sbjct: 36 IVVKYGGNAMTE--DDLMASFARDIVLMKLVGMNPVVVHGGGPQIGDLLKRVGKESEFIQ 93 Query: 54 SASGIKFRYTDEKELEVFVAVLGGLLNKKIVASFASYGRGAVGLTGADGPSVIAERKKKV 113 R TD + +++ VLGGL+NK+IV +G +VGLTG DG ++A KK+ Sbjct: 94 G-----MRVTDTETMDIVEMVLGGLVNKEIVNLIHQHGGNSVGLTGKDGNMIMA---KKL 145 Query: 114 IVQEKVGERLVKRAIAGGYTGKIKEVKTDLIKALVERGLVPVVAPIALSPEGELLNVNGD 173 V ++ V I G+ G+++ + T +I L++ +PV+AP+ + EG N+N D Sbjct: 146 KVTKQTPGMDVPEIIDIGHVGEVERINTGVIDMLIKGDFIPVIAPVGVDAEGNSYNINAD 205 Query: 174 QMAAELAKALSAEYLVLLTDVPGVL-MDGKVVPEIKSSEAEEVAK--KVGPGMNIKIIMA 230 +A ++A+AL AE L+LLT+ PG+L G+++ + + +E+ + GM KI A Sbjct: 206 LVAGKVAEALQAEKLMLLTNTPGLLNKQGELLTGLNAKMVDELIADGTIYGGMLPKIQCA 265 Query: 231 GRVASGGTKVV-ICDGTV 247 GG K V I DG V Sbjct: 266 LDAVQGGVKAVHIVDGRV 283 Lambda K H 0.316 0.136 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 304 Length adjustment: 26 Effective length of query: 238 Effective length of database: 278 Effective search space: 66164 Effective search space used: 66164 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory