Align Probable aspartate/prephenate aminotransferase; AspAT / PAT; EC 2.6.1.1; EC 2.6.1.79; Transaminase A (uncharacterized)
to candidate WP_038150458.1 B076_RS0106355 alanine transaminase
Query= curated2:O86459 (400 letters) >NCBI__GCF_000483485.1:WP_038150458.1 Length = 397 Score = 142 bits (357), Expect = 2e-38 Identities = 115/393 (29%), Positives = 183/393 (46%), Gaps = 21/393 (5%) Query: 8 LSRVKPSATIAVSQKARELKAKGRDVIGLGAGEPDFDTPDNIKKAAIDAINR-GETKYTP 66 + R+ P V + E + +G D+I G G PD DTP +I I+ + R G +Y+ Sbjct: 7 IKRLPPYVFNIVGELKAEARRRGEDIIDFGMGNPDQDTPKHIVDKLIEVVQREGTHRYSV 66 Query: 67 VSGIPELRKAIAAKFKRENGLDYSWE-QTIVGTGGKQILFNAFMATLNPGDEVSIPAPYW 125 GIP LRKAI +K + +D + + +V G K+ L + +AT+ GD V +P P + Sbjct: 67 SQGIPRLRKAICNWYKSKYDVDLDADTEAVVTIGSKEGLAHLALATVEKGDTVLVPNPAY 126 Query: 126 VSYPEMVALCGGTRFFVSATQEHNFKLQAADLEKAIT---PKTKWFIFNSPSNPTGAAYT 182 +P + G V T + +F +LEKAI PK K + N P NPT Sbjct: 127 PIHPYGFVIAGADIRHVRMTPDVDF---FDELEKAIKESWPKPKMLVLNFPGNPTTQTVD 183 Query: 183 HDELKALTDVLMKNPQVWVLTDDMYEHLTYGDFKFVTPVEVEPQLYDRTLTMNGVSKAYA 242 + + + + K +WV+ D Y + + +K + ++VE D + +SK+Y Sbjct: 184 LEFFEKVI-AIAKEHNIWVIHDLAYADIVFDGYKAPSILQVEGAK-DIAVEFYTLSKSYN 241 Query: 243 MTGWRIGYAAGPIQLIKAMDMIQGQQTSGATSIAQWAAVEALNGTQDFIPENKKIFEGRR 302 M GWR+G+ G L+ A+ ++ G + Q AA+ AL G QD + E +++ RR Sbjct: 242 MPGWRVGFMVGNPVLVNALKRMKSYLDYGTFTPIQVAAIAALEGPQDCVQEICDMYKSRR 301 Query: 303 DLVVSMLNQAKGIVCPVPEGAFYVYPSCKGLIGKTAPSGKVIETDEDFVSELLESEGVAV 362 D++ LN A G P+ +V+ I + S IE F +LL VAV Sbjct: 302 DVLCQGLN-AIGWKVEPPKATMFVWAP----IPEEYKSMGSIE----FSKKLLTEAKVAV 352 Query: 363 VHGSAFG--LGPNFRISYATSEEQLEEACRRIQ 393 G FG + R +E + +A R I+ Sbjct: 353 SPGVGFGDYGDDHVRFGLIENEHRTRQAIRGIR 385 Lambda K H 0.317 0.134 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 397 Length adjustment: 31 Effective length of query: 369 Effective length of database: 366 Effective search space: 135054 Effective search space used: 135054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory