Align homoserine dehydrogenase (EC 1.1.1.3); aspartate kinase (EC 2.7.2.4) (characterized)
to candidate WP_038201031.1 Q392_RS02875 homoserine dehydrogenase
Query= BRENDA::Q9WZ17 (739 letters) >NCBI__GCF_000745855.1:WP_038201031.1 Length = 440 Score = 208 bits (529), Expect = 5e-58 Identities = 132/347 (38%), Positives = 196/347 (56%), Gaps = 9/347 (2%) Query: 17 VRKVRVGIAGLGTVGGSIYRILKERGNEIEKRIGEKFIISKVINRSPQKYELLGVPKEEI 76 ++ ++VG+ G+GTVGG +++L+ EI++R G I+ V + + + + ++ Sbjct: 1 MKPIQVGLLGIGTVGGGTFKVLQRNQEEIKRRAGRGIEITMVADLDTARAQAVAGEGVKV 60 Query: 77 AFDFDDLILNSDV--VVEAIGGTDVAVDLVRRALELGRIVVTPNKNLISEYGNEFSEYIK 134 D ++I N D+ V+E IGG VA LV A+ G+ VVT NK L++ +G E Sbjct: 61 VGDAREVIANPDIDIVIELIGGYGVARTLVLEAIAAGKHVVTANKALLAVHGTEIFAAAH 120 Query: 135 KRKLF--FEASVGGGIPIISLLQDYLIFQKVTRIRGIMNGTTNYILTEM-SKGRHFEEVL 191 R + FEA+V GGIPII L++ L ++ I GI+NGTTN+IL+EM KG F+ VL Sbjct: 121 ARGVMVAFEAAVAGGIPIIKALREGLTANRIQWIAGIINGTTNFILSEMRDKGLDFDVVL 180 Query: 192 KEAQELGYAEADPTNDIEGYDVAYKVSVLAGVVTGRFPGINSVQFEGITRIDPEYLKEIV 251 KEAQ LGYAEADPT DIEG D A+K ++++ + G + EGITR+ + ++ Sbjct: 181 KEAQRLGYAEADPTFDIEGVDAAHKATIMSAIAFGIPVQFDKAHVEGITRLASQDIRYAE 240 Query: 252 RSGKKLKLIGELDFSTNRYEVRLRE--VTPEDPFFNVDGVDNAIEVSTDLAGDFLLKGRG 309 + G ++KL+G E+R+ V + NV+G NA+ V D G L G+G Sbjct: 241 QLGYRIKLLGITKRVPKGIELRVHPALVPAKRLLANVEGAMNAVVVHGDAVGTTLYYGKG 300 Query: 310 AGGYPTASAVIADLFRVAKYKVLGGAEKFSVVVMKFGGAAISDVEKL 356 AG PTASAVIADL +A+ A + V + F A+SD L Sbjct: 301 AGSEPTASAVIADLVDIARLHTADAAHR--VPHLAFQADAMSDAPVL 345 Score = 28.5 bits (62), Expect = 8e-04 Identities = 11/27 (40%), Positives = 19/27 (70%) Query: 605 VPDKPGVAARIMRTLSQMGVNIDMIIQ 631 V D+ GV AR+ L++ G++ID ++Q Sbjct: 360 VADEAGVLARVTSLLAEAGISIDAVLQ 386 Lambda K H 0.318 0.137 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 770 Number of extensions: 32 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 739 Length of database: 440 Length adjustment: 36 Effective length of query: 703 Effective length of database: 404 Effective search space: 284012 Effective search space used: 284012 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory