Align Homoserine kinase; HK; HSK; EC 2.7.1.39 (characterized)
to candidate WP_038205143.1 Q392_RS09140 homoserine kinase
Query= SwissProt::P29364 (316 letters) >NCBI__GCF_000745855.1:WP_038205143.1 Length = 353 Score = 202 bits (513), Expect = 1e-56 Identities = 134/333 (40%), Positives = 171/333 (51%), Gaps = 28/333 (8%) Query: 1 MSVFTPLERSTLEAFLAPYDLGRLRDFRGIAEGSENSNFFVSLEHGEFVLTLVERGPVQD 60 M+VFT + A + LG L+ RGI G EN+N+F S + GE+VLTL ER Sbjct: 1 MAVFTEVGAEEAGALMRRLGLGELQSLRGIEGGIENTNYFASTDQGEWVLTLFERLHADQ 60 Query: 61 LPFFIELLDVLHEDGLPVP-------YALRTRDGE-----------ALRRLEGKPALLQP 102 LP+++ L+ L E GLPVP A D L + GKPA + Sbjct: 61 LPYYLCLMKHLAERGLPVPEPAADPTQAAPAADAHPLEVTANAPCALLHTVAGKPAAVVR 120 Query: 103 RLAGRHERQPNAHHCQEVGDLLGHLHAATRGRILERPSDRGLPWMLEQGANLAPRLPEQA 162 RLAG E P HHC+E+G LL +H A R +P+ RGL W E + P L E Sbjct: 121 RLAGHSELAPGEHHCRELGALLARMHLAARDFPRIQPNLRGLAWWNETAPVVMPHLDEHQ 180 Query: 163 RALLAPALA--EIAALDAERPALPRANLHADLFRDNVLF------DGPHLAGLIDFYNAC 214 ALLA LA A + ALPR +HADLFRDN +F + P L G+ DFY A Sbjct: 181 AALLAGELAYQNHVAASSAYAALPRGPVHADLFRDNAMFSEGAPGEPPRLTGVFDFYFAG 240 Query: 215 SGWMLYDLAITLNDWCSN-TDGSLDPARARALLAAYANRRPFTALEAEHWPSMLRVACVR 273 + L+D+A+ LNDW + G+ D AR ALL AY + RP TA E P+MLR +R Sbjct: 241 TDTWLFDIAVCLNDWAIDLPTGTPDAARGAALLDAYQSVRPLTAAERTLLPAMLRAGALR 300 Query: 274 FWLSRLIAAEAFAGQDVL-IHDPAEFEIRLAQR 305 FW+SRL +L HDPA FE L +R Sbjct: 301 FWISRLWDFHLPREASMLKAHDPAHFERVLRRR 333 Lambda K H 0.324 0.140 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 15 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 353 Length adjustment: 28 Effective length of query: 288 Effective length of database: 325 Effective search space: 93600 Effective search space used: 93600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
Align candidate WP_038205143.1 Q392_RS09140 (homoserine kinase)
to HMM TIGR00938 (thrB: homoserine kinase (EC 2.7.1.39))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00938.hmm # target sequence database: /tmp/gapView.28309.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00938 [M=307] Accession: TIGR00938 Description: thrB_alt: homoserine kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-88 280.9 0.0 2.1e-86 276.0 0.0 2.0 1 lcl|NCBI__GCF_000745855.1:WP_038205143.1 Q392_RS09140 homoserine kinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000745855.1:WP_038205143.1 Q392_RS09140 homoserine kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 276.0 0.0 2.1e-86 2.1e-86 1 306 [. 1 331 [. 1 332 [. 0.88 Alignments for each domain: == domain 1 score: 276.0 bits; conditional E-value: 2.1e-86 TIGR00938 1 mavytsvsdeeleafLegydlGellslkGiaeGvensnyllttdkgryvLtlyekrvkaeeLPfflell 69 mav+t+v ee a + lGel sl+Gi G+en+ny+ td+g +vLtl+e+ a++LP++l l+ lcl|NCBI__GCF_000745855.1:WP_038205143.1 1 MAVFTEVGAEEAGALMRRLGLGELQSLRGIEGGIENTNYFASTDQGEWVLTLFERLH-ADQLPYYLCLM 68 9******************************************************99.*********** PP TIGR00938 70 thLaerglpvakpvk..................srdGralseLaGkPaalvefLkGssvakPtaercre 120 +hLaerglpv++p + + ++l ++aGkPaa+v L+G+s P ++cre lcl|NCBI__GCF_000745855.1:WP_038205143.1 69 KHLAERGLPVPEPAAdptqaapaadahplevtaNAPCALLHTVAGKPAAVVRRLAGHSELAPGEHHCRE 137 **********987642211111111111111112234678899************************** PP TIGR00938 121 vgevlaklhlagadfkeerkndlrleaWsilaakkfkvleqleeelaalldkeldalkkflpr....dL 185 g+ la++hla+ df+ + n lr aW+ ++a v+++l+e++aall el++ +++ + L lcl|NCBI__GCF_000745855.1:WP_038205143.1 138 LGALLARMHLAARDFPRIQPN-LRGLAWWNETAPV--VMPHLDEHQAALLAGELAYQNHVAASsayaAL 203 *********************.***********99..*******************998876422227* PP TIGR00938 186 Prgvihadlfkdnvlldgd......klkgvidfyfaCedallydlaiavndWcfea.ddkldaaaakal 247 Prg +hadlf+dn ++ + +l+gv dfyfa +d++l+d+a+++ndW+++ ++ daa+ al lcl|NCBI__GCF_000745855.1:WP_038205143.1 204 PRGPVHADLFRDNAMFSEGapgeppRLTGVFDFYFAGTDTWLFDIAVCLNDWAIDLpTGTPDAARGAAL 272 ***************964323333359****************************72568899****** PP TIGR00938 248 lkgyeavrpLseeekaafpvllrgaalrfllsrlldlvftqagelvvakdPaeferkLk 306 l++y++vrpL++ e+ +p +lr++alrf++srl+d++ ++ + +a dPa+fer L+ lcl|NCBI__GCF_000745855.1:WP_038205143.1 273 LDAYQSVRPLTAAERTLLPAMLRAGALRFWISRLWDFHLPREASMLKAHDPAHFERVLR 331 ********************************************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (307 nodes) Target sequences: 1 (353 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.04 # Mc/sec: 2.28 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory