Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate WP_038207680.1 Q392_RS12905 4-hydroxy-tetrahydrodipicolinate synthase
Query= BRENDA::Q9I4W3 (292 letters) >NCBI__GCF_000745855.1:WP_038207680.1 Length = 296 Score = 333 bits (855), Expect = 2e-96 Identities = 169/291 (58%), Positives = 213/291 (73%), Gaps = 1/291 (0%) Query: 2 IAGSMVALVTPFDAQGRLDWDSLAKLVDFHLQEGTNAIVAVGTTGESATLDVEEHIQVIR 61 + GS+VALVTP G +D+D+L +L+D+H+ EGT+ I VGTTGES T+DVEEH ++IR Sbjct: 4 LTGSIVALVTPMHEDGSVDYDALRRLIDWHIAEGTDCIGVVGTTGESPTVDVEEHCEIIR 63 Query: 62 RVVDQVKGRIPVIAGTGANSTREAVALTEAAKSGGADACLLVTPYYNKPTQEGMYQHFRH 121 V+Q GR+PV+AG GANST EA+ L AK GAD+ L V PYYNKPTQEG Y+HF Sbjct: 64 VSVEQAAGRVPVMAGCGANSTAEAIELARFAKGVGADSQLQVVPYYNKPTQEGQYRHFEA 123 Query: 122 IAEAVA-IPQILYNVPGRTSCDMLPETVERLSKVPNIIGIKEATGDLQRAKEVIERVGKD 180 IAEAV +P +LYNVPGRT DM +TV RL++VP I+GIKEATG+++RA+ +I V K+ Sbjct: 124 IAEAVGDLPMVLYNVPGRTVADMAHDTVLRLARVPGIVGIKEATGNIERAQWLIREVPKE 183 Query: 181 FLVYSGDDATAVELMLLGGKGNISVTANVAPRAMSDLCAAAMRGDAAAARAINDRLMPLH 240 F VYSGDD TAV LML GG+GNISVTANVAPR M +LC AA+ GDA A + LMPLH Sbjct: 184 FAVYSGDDPTAVALMLCGGQGNISVTANVAPRKMHELCVAAIAGDARTAMRLQFELMPLH 243 Query: 241 KALFIESNPIPVKWALHEMGLIPEGIRLPLTWLSPRCHEPLRQAMRQTGVL 291 + LF+E NPIPVKWAL MG + +RLP+T LS + A++ G+L Sbjct: 244 RNLFVEPNPIPVKWALARMGRMGGALRLPMTELSEAHRPTVEAALQACGLL 294 Lambda K H 0.319 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 310 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 296 Length adjustment: 26 Effective length of query: 266 Effective length of database: 270 Effective search space: 71820 Effective search space used: 71820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_038207680.1 Q392_RS12905 (4-hydroxy-tetrahydrodipicolinate synthase)
to HMM TIGR00674 (dapA: 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00674.hmm # target sequence database: /tmp/gapView.17933.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00674 [M=286] Accession: TIGR00674 Description: dapA: 4-hydroxy-tetrahydrodipicolinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-112 360.3 0.0 2.9e-112 360.1 0.0 1.0 1 lcl|NCBI__GCF_000745855.1:WP_038207680.1 Q392_RS12905 4-hydroxy-tetrahydr Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000745855.1:WP_038207680.1 Q392_RS12905 4-hydroxy-tetrahydrodipicolinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 360.1 0.0 2.9e-112 2.9e-112 1 284 [. 6 289 .. 6 291 .. 0.99 Alignments for each domain: == domain 1 score: 360.1 bits; conditional E-value: 2.9e-112 TIGR00674 1 gvltAliTPfkedgsvdfaalekliesqiekgvdaivvvGtTGEsatLsleEkkkvievavelvknrvp 69 g+++Al+TP++edgsvd++al +li+ +i++g+d i vvGtTGEs+t +eE+ ++i+v+ve +++rvp lcl|NCBI__GCF_000745855.1:WP_038207680.1 6 GSIVALVTPMHEDGSVDYDALRRLIDWHIAEGTDCIGVVGTTGESPTVDVEEHCEIIRVSVEQAAGRVP 74 589****************************************************************** PP TIGR00674 70 viaGtgsnateeaieltkeaeklgvdgvlvvtPyYnkPtqeGlykhfkaiaeev.elPiilYnvPsRtg 137 v+aG+g+n+t+eaiel+++a+ +g+d+ l+v+PyYnkPtqeG+y+hf+aiae+v +lP++lYnvP+Rt+ lcl|NCBI__GCF_000745855.1:WP_038207680.1 75 VMAGCGANSTAEAIELARFAKGVGADSQLQVVPYYNKPTQEGQYRHFEAIAEAVgDLPMVLYNVPGRTV 143 *****************************************************99************** PP TIGR00674 138 vslepetvkrLaeeveivaiKeasgdlervseikaeakedfkvlsGdDaltleilalGakGviSVasnv 206 ++++ +tv+rLa+ + iv+iKea+g++er++ +++e++++f+v+sGdD ++ +++++G++G iSV++nv lcl|NCBI__GCF_000745855.1:WP_038207680.1 144 ADMAHDTVLRLARVPGIVGIKEATGNIERAQWLIREVPKEFAVYSGDDPTAVALMLCGGQGNISVTANV 212 ********************************************************************* PP TIGR00674 207 apkelkemvkaalegdteeareihqkllklfkalfietNPipvKtalallgliekdelRlPLtelseek 275 ap++++e++ aa++gd + a ++ +l++l++ lf+e+NPipvK+ala +g + + +lRlP+telse + lcl|NCBI__GCF_000745855.1:WP_038207680.1 213 APRKMHELCVAAIAGDARTAMRLQFELMPLHRNLFVEPNPIPVKWALARMGRMGG-ALRLPMTELSEAH 280 *******************************************************.************* PP TIGR00674 276 keklkevlk 284 + +++++l+ lcl|NCBI__GCF_000745855.1:WP_038207680.1 281 RPTVEAALQ 289 *****9997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (286 nodes) Target sequences: 1 (296 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.58 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory