Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_038208711.1 Q392_RS14170 triose-phosphate isomerase
Query= BRENDA::P0A858 (255 letters) >NCBI__GCF_000745855.1:WP_038208711.1 Length = 251 Score = 242 bits (617), Expect = 6e-69 Identities = 128/245 (52%), Positives = 161/245 (65%), Gaps = 2/245 (0%) Query: 5 LVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIMLGAQ 64 L+ GNWK+NGS LV LR + G +GC VA+ P Y+ + GS I LGAQ Sbjct: 8 LIAGNWKMNGSLAANEALVQALRAGV-GQSGCDVAVCVPSPYLAQVQSLVAGSPIALGAQ 66 Query: 65 NVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPV 124 +V + GA+TGE SAAMLKD G +Y I+GHSERR YH ESD+ +A K G+TP+ Sbjct: 67 DVSAHAQGAYTGEQSAAMLKDFGVRYAIVGHSERRQYHGESDDAVAAKAGAALGAGITPI 126 Query: 125 LCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQ 184 +C+GET AE EAG T EV RQ+ AV+ G E V+AYEPVWAIGTGK+ATP +AQ Sbjct: 127 VCVGETLAEREAGHTAEVVRRQLAAVIHANGHCITE-IVVAYEPVWAIGTGKTATPEEAQ 185 Query: 185 AVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAV 244 AVH +R + + A ++ I YGGS+NA+NAA L AQPD+DG L+GGASLKA F Sbjct: 186 AVHAVLRAQLHHAAGDGAARIRILYGGSMNAANAASLLAQPDVDGGLIGGASLKAPDFLQ 245 Query: 245 IVKAA 249 I+ AA Sbjct: 246 IIAAA 250 Lambda K H 0.316 0.130 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 209 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 251 Length adjustment: 24 Effective length of query: 231 Effective length of database: 227 Effective search space: 52437 Effective search space used: 52437 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
Align candidate WP_038208711.1 Q392_RS14170 (triose-phosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00419.hmm # target sequence database: /tmp/gapView.10535.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00419 [M=228] Accession: TIGR00419 Description: tim: triose-phosphate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-70 221.8 4.7 5.9e-70 221.6 4.7 1.0 1 lcl|NCBI__GCF_000745855.1:WP_038208711.1 Q392_RS14170 triose-phosphate is Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000745855.1:WP_038208711.1 Q392_RS14170 triose-phosphate isomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 221.6 4.7 5.9e-70 5.9e-70 1 227 [. 8 240 .. 8 241 .. 0.98 Alignments for each domain: == domain 1 score: 221.6 bits; conditional E-value: 5.9e-70 TIGR00419 1 lviinfKlnesvgkvelevaklaeevaseagvevavappfvdldvvkdeve.seiqvaAqnvdavksGa 68 l+ +n+K+n+s+ e +v+ l++ v ++g+ vav +p +l v+ v s i ++Aq+v a+ +Ga lcl|NCBI__GCF_000745855.1:WP_038208711.1 8 LIAGNWKMNGSLAANEALVQALRAGVG-QSGCDVAVCVPSPYLAQVQSLVAgSPIALGAQDVSAHAQGA 75 689**********************95.68********************999**************** PP TIGR00419 69 ftGeisAemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleereaartinn 137 +tGe sA+mlkd+G+++ ++gHsErR ++ e+d+ +++k + g++++vCvgetl+erea++t ++ lcl|NCBI__GCF_000745855.1:WP_038208711.1 76 YTGEQSAAMLKDFGVRYAIVGHSERRQYHGESDDAVAAKAGAALGAGITPIVCVGETLAEREAGHTAEV 144 ********************************************************************* PP TIGR00419 138 vattaaaaA......lepdvvAvEPveliGtGkpvskAeaevveksvrdhlkkvskevaesvrvlyGas 200 v ++ aa+ +++ vvA+EPv++iGtGk++++ ea++v++ +r l++++ + a +r+lyG+s lcl|NCBI__GCF_000745855.1:WP_038208711.1 145 VRRQLAAVIhanghcITEIVVAYEPVWAIGTGKTATPEEAQAVHAVLRAQLHHAAGDGAARIRILYGGS 213 ****9998778999999**************************************************** PP TIGR00419 201 vtaaedaelaaqldvdGvLlasavlka 227 ++aa++a l aq+dvdG L+++a+lka lcl|NCBI__GCF_000745855.1:WP_038208711.1 214 MNAANAASLLAQPDVDGGLIGGASLKA 240 **************************8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (228 nodes) Target sequences: 1 (251 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.36 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory