Align glutamate N-acetyltransferase/amino-acid acetyltransferase; EC 2.3.1.35 2.3.1.1 (characterized)
to candidate WP_038209631.1 Q392_RS15655 bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ
Query= CharProtDB::CH_000559 (406 letters) >NCBI__GCF_000745855.1:WP_038209631.1 Length = 409 Score = 440 bits (1131), Expect = e-128 Identities = 233/410 (56%), Positives = 288/410 (70%), Gaps = 5/410 (1%) Query: 1 MAVNLTEKTAEQLPDIDGIALYTAQAGVKKPGHTDLTLIAVAAGSTVGAVFTTNRFCAAP 60 M V+L + L + G+ + A+AGV+K DLT++ + G+ V VFT NRFCAAP Sbjct: 1 MPVHLAAPDPQSLHPVAGLRIGVAEAGVRKANRKDLTVMLLDEGAAVAGVFTQNRFCAAP 60 Query: 61 VHIAKSHLFDEDGVRALVINTGNANAGTGAQGRIDALAVCAAAARQIGCKPNQVMPFSTG 120 V + + HL G+RALVINTGNANAGTGA G + A + C A AR++ P QV+PFSTG Sbjct: 61 VQVCREHLAQNFGIRALVINTGNANAGTGADGLVCARSTCIALARRLEIAPEQVLPFSTG 120 Query: 121 VILEPLPADKIIAALPKM----QPAFWNEAARAIMTTDTVPKAASREGKVGDQHTVRATG 176 VI+EPLP D+I AALP A W AA IMTTDTVPKA SR+ +VG TV TG Sbjct: 121 VIMEPLPTDRIEAALPAALADAAEANWARAAEGIMTTDTVPKAFSRQVQVGGA-TVTITG 179 Query: 177 IAKGSGMIHPNMATMLGFIATDAKVSQPVLQLMTQEIADETFNTITVDGDTSTNDSFVII 236 I+KG+GMI PNMATMLGF+ATDA+++ +L + + +AD +FN +T+DGDTSTNDSFV+I Sbjct: 180 ISKGAGMIRPNMATMLGFLATDARIAPELLAPLARRLADGSFNRVTIDGDTSTNDSFVVI 239 Query: 237 ATGKNSQSEIDNIADPRYAQLKELLCSLALELAQAIVRDGEGATKFITVRVENAKTCDEA 296 AT K + +D++A L + +A LAQAIVRDGEGATKFIT+RVE + E Sbjct: 240 ATQKAGNAVVDSLASADGRALVAAMEEVARLLAQAIVRDGEGATKFITIRVEGGRDAAEC 299 Query: 297 RQAAYAAARSPLVKTAFFASDPNLGKRLAAIGYADVADLDTDLVEMYLDDILVAEHGGRA 356 RQ AYA A SPLVKTAF+ASDPNLG+ LAA+GYA +ADLD +E++LDD+ VA GGR Sbjct: 300 RQVAYAVAHSPLVKTAFYASDPNLGRILAAVGYAGIADLDQTGIELHLDDVHVATRGGRH 359 Query: 357 ASYTEAQGQAVMSKDEITVRIKLHRGQAAATVYTCDLSHGYVSINADYRS 406 Y E GQ VM + EITVRI L RG AA TV+TCDLSH YVSINADYRS Sbjct: 360 PGYQEEDGQRVMKQSEITVRIGLGRGDAADTVWTCDLSHDYVSINADYRS 409 Lambda K H 0.317 0.130 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 466 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 409 Length adjustment: 31 Effective length of query: 375 Effective length of database: 378 Effective search space: 141750 Effective search space used: 141750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory