Align Glutamyl-tRNA(Gln) amidotransferase subunit A; Glu-ADT subunit A; EC 6.3.5.7 (characterized)
to candidate WP_038210743.1 Q392_RS18225 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA
Query= SwissProt::O06491 (485 letters) >NCBI__GCF_000745855.1:WP_038210743.1 Length = 495 Score = 463 bits (1192), Expect = e-135 Identities = 240/486 (49%), Positives = 327/486 (67%), Gaps = 11/486 (2%) Query: 8 ITELKQLIHKKEIKISDLVDESYKRIQAVDDKVQAFLALDEERARAYAKELDEAVDGRSE 67 + L + + +E+ + R++A D + AF+++DEE A A+ D A+ + Sbjct: 10 VAALARALAAREVSAEEAARHFLGRMKAHQD-LAAFVSVDEEATLAQARAADAAL-AAGK 67 Query: 68 HGLLFGMPIGVKDNIVTKGLRTTCSSKILENFDPIYDATVVQRLQDAEAVTIGKLNMDEF 127 G L G+PI KD VT G +T S++L ++ +DATVV++L A VT+GKL+ DEF Sbjct: 68 AGPLAGVPIAHKDIFVTTGWPSTAGSRMLADYRSPFDATVVRKLAGAGMVTLGKLSCDEF 127 Query: 128 AMGSSTEN--------SAYKLTKNPWNLDTVPGGSSGGSAAAVAAGEVPFSLGSDTGGSI 179 AMGS+ EN A +NPW+ + VPGGSSGGSA AVAA P + G+DTGGSI Sbjct: 128 AMGSANENVAVPAAGLDAVSPVRNPWDRERVPGGSSGGSAVAVAAALAPAATGTDTGGSI 187 Query: 180 RQPASFCGVVGLKPTYGRVSRYGLVAFASSLDQIGPITRTVEDNAFLLQAISGVDK-MDS 238 RQPASFCG+ G+KPTYGR SRYG++AFASSLDQ GP+ R+ ED A LL A+ G D DS Sbjct: 188 RQPASFCGITGIKPTYGRASRYGMIAFASSLDQAGPMARSAEDCALLLSAMCGPDPDRDS 247 Query: 239 TSANVDVPDFLSSLTGDIKGLKIAVPKEYLGEGVGKEARESVLAALKVLEGLGATWEEVS 298 TS +V DF L ++GL+I VPKE++GEGV R ++ AAL E LGA EVS Sbjct: 248 TSLDVPAEDFSRQLHASLEGLRIGVPKEFVGEGVAPGVRAAIEAALAEYEKLGARRVEVS 307 Query: 299 LPHSKYALATYYLLSSSEASANLARFDGIRYGYRTDNADNLIDLYKQTRAEGFGNEVKRR 358 LP ++ ++ YY+L+++EAS+NL+RFDG+++G+R +L ++Y +TRAEGFG+EVKRR Sbjct: 308 LPRTELSIPVYYILAAAEASSNLSRFDGVKFGHRAAQYKDLAEMYAKTRAEGFGDEVKRR 367 Query: 359 IMLGTFALSSGYYDAYYKKAQKVRTLIKKDFEDVFEKYDVIVGPTTPTPAFKIGENTKDP 418 IM+GT+ LS GYYDAYY +AQKVR +I DF+ F DVI GP PT A+KIGE+ DP Sbjct: 368 IMIGTYVLSHGYYDAYYLQAQKVRRMIADDFQQAFRDCDVIAGPAAPTVAWKIGEHGGDP 427 Query: 419 LTMYANDILTIPVNLAGVPGISVPCGLADGLPLGLQIIGKHFDESTVYRVAHAFEQATDH 478 + Y D+ T+P +LAG+PG+SVPCG +P+GLQ+IG +F E+ + AH F+QATD Sbjct: 428 VADYLADVFTLPASLAGLPGMSVPCGFDGSMPVGLQLIGNYFGEAKLLNAAHRFQQATDW 487 Query: 479 HKAKPE 484 H+ PE Sbjct: 488 HRKTPE 493 Lambda K H 0.315 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 602 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 485 Length of database: 495 Length adjustment: 34 Effective length of query: 451 Effective length of database: 461 Effective search space: 207911 Effective search space used: 207911 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
Align candidate WP_038210743.1 Q392_RS18225 (Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA)
to HMM TIGR00132 (gatA: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit (EC 6.3.5.-))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00132.hmm # target sequence database: /tmp/gapView.12300.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00132 [M=466] Accession: TIGR00132 Description: gatA: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-171 556.0 0.0 4e-171 555.8 0.0 1.0 1 lcl|NCBI__GCF_000745855.1:WP_038210743.1 Q392_RS18225 Asp-tRNA(Asn)/Glu-t Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000745855.1:WP_038210743.1 Q392_RS18225 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 555.8 0.0 4e-171 4e-171 3 465 .. 15 486 .. 13 487 .. 0.96 Alignments for each domain: == domain 1 score: 555.8 bits; conditional E-value: 4e-171 TIGR00132 3 ellkkkevsikevleeilerieavkdkinaflevtkekalkkakkldkkva.ke.kklagipiavKdni 69 ++l ++evs++e+++++l r++a++d + af++v++e +l++a++ d+++a + +lag+pia Kd + lcl|NCBI__GCF_000745855.1:WP_038210743.1 15 RALAAREVSAEEAARHFLGRMKAHQD-LAAFVSVDEEATLAQARAADAALAaGKaGPLAGVPIAHKDIF 82 568899********************.**********************9975537************* PP TIGR00132 70 avkdiettcaSkiLenyvspydatVverlkeagaliiGktNlDEFamGsstetSa........fgvtkn 130 ++ +++ t++S++L +y+sp+datVv++l ag++++Gk DEFamGs+ e+ a +++n lcl|NCBI__GCF_000745855.1:WP_038210743.1 83 VTTGWPSTAGSRMLADYRSPFDATVVRKLAGAGMVTLGKLSCDEFAMGSANENVAvpaagldaVSPVRN 151 **************************************************9986422222222689*** PP TIGR00132 131 PeneervpGGSsgGsaaavaadlvplalgsDTGgSiRqPAsfcgvvGlKPtYGlvSRyGlvayasSldq 199 P+++ervpGGSsgGsa avaa l+p a g+DTGgSiRqPAsfcg+ G+KPtYG+ SRyG++a+asSldq lcl|NCBI__GCF_000745855.1:WP_038210743.1 152 PWDRERVPGGSSGGSAVAVAAALAPAATGTDTGGSIRQPASFCGITGIKPTYGRASRYGMIAFASSLDQ 220 ********************************************************************* PP TIGR00132 200 iGilakkvedialvldvisgkD.kkDstslevkveelleelkkdlkglkvgvvkelseesldkevkekf 267 G++a++ ed al+l++++g D +Dstsl+v+ e++ ++l++ l gl++gv ke+ +e++ +v++++ lcl|NCBI__GCF_000745855.1:WP_038210743.1 221 AGPMARSAEDCALLLSAMCGPDpDRDSTSLDVPAEDFSRQLHASLEGLRIGVPKEFVGEGVAPGVRAAI 289 **********************559******************************************** PP TIGR00132 268 ekllekleelgaeivevslpsvklalaiYyiispsEassnlarydgiryGkrveelkslkelyaktRse 336 e++l + e+lga vevslp+ +l++++Yyi++ +Eassnl+r+dg+++G+r+ ++k+l e+yaktR+e lcl|NCBI__GCF_000745855.1:WP_038210743.1 290 EAALAEYEKLGARRVEVSLPRTELSIPVYYILAAAEASSNLSRFDGVKFGHRAAQYKDLAEMYAKTRAE 358 ********************************************************************* PP TIGR00132 337 gfgeevkrRimlGayalskeyydkyykkAqkvrtliidefeklfeevDvivsptaptlafklgekaedp 405 gfg+evkrRim+G+y+ls++yyd+yy++Aqkvr++i+d+f+++f+++Dvi++p+apt+a k+ge+ dp lcl|NCBI__GCF_000745855.1:WP_038210743.1 359 GFGDEVKRRIMIGTYVLSHGYYDAYYLQAQKVRRMIADDFQQAFRDCDVIAGPAAPTVAWKIGEHGGDP 427 ********************************************************************* PP TIGR00132 406 lemylsDvltvpanlaGlpaisvPlgkkekglpiGlqiigkafddkkllsvakaleqald 465 ++ yl+Dv+t+pa+laGlp++svP+g + +p+Glq+ig++f + kll++a+ ++qa+d lcl|NCBI__GCF_000745855.1:WP_038210743.1 428 VADYLADVFTLPASLAGLPGMSVPCGFD-GSMPVGLQLIGNYFGEAKLLNAAHRFQQATD 486 ****************************.69*************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (466 nodes) Target sequences: 1 (495 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 7.98 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory