Align Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 (characterized)
to candidate WP_038217091.1 Q392_RS28990 succinyl-diaminopimelate desuccinylase
Query= SwissProt::Q9JYL2 (381 letters) >NCBI__GCF_000745855.1:WP_038217091.1 Length = 407 Score = 420 bits (1079), Expect = e-122 Identities = 217/406 (53%), Positives = 271/406 (66%), Gaps = 29/406 (7%) Query: 4 TQSLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGDTK----NIWLRRG-- 57 T++L LA++LI+ PSVTP+D CQ+L+ ERL ++GFA E + G T N+W R Sbjct: 2 TRTLHLAEQLIATPSVTPEDGGCQQLIGERLARLGFALERIESGPTDFRVTNLWAVRRPG 61 Query: 58 -------------------TKAPVVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRG 98 APV+ FAGHTDVVPTGP+E+W SPPF P R G LYGRG Sbjct: 62 PSAAAPAPGAAIPATPIPPVDAPVLVFAGHTDVVPTGPLEQWTSPPFTPTHRGGLLYGRG 121 Query: 99 AADMKTSIACFVTACERFVAKHPNHQGSIALLITSDEEGDALDGTTKVVDVLKARDELID 158 A DMK+S+A FV A E F+A P+ + ++ALL+TSDEEG +DGT V L AR + +D Sbjct: 122 ACDMKSSLAAFVVAIEEFLAAEPSPRIALALLLTSDEEGPGVDGTVVVCRELAARGQRLD 181 Query: 159 YCIVGEPTAVDKLGDMIKNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLEL-- 216 +CIVGEPT+V + GDMIKNGRRG++SG LT +G QGHIAYPHLA NPVH APAL EL Sbjct: 182 WCIVGEPTSVQRCGDMIKNGRRGTMSGRLTARGVQGHIAYPHLAKNPVHALAPALAELVA 241 Query: 217 --TQEVWDEGNEYFPPTSFQISNINGGTGATNVIPGELNVKFNFRFSTESTEAGLKQRVH 274 + WD GN +F PTS+Q+SNI+ GTGA+NVIPG V FNFRFSTEST L+ RV Sbjct: 242 INAEGGWDAGNAFFQPTSWQVSNIHAGTGASNVIPGTAVVDFNFRFSTESTPESLQSRVQ 301 Query: 275 AILDKHGVQYDLQWSCSGQPFLTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKA 334 +LD+HG+ Y+L W+ G PFLTQ G L + AI E GIE ELST+GGTSD RFI Sbjct: 302 GVLDRHGLDYELAWTVGGLPFLTQPGALVAAVQGAIREETGIETELSTSGGTSDARFIAK 361 Query: 335 IAQELIELGPSNATIHQINENVRLNDIPKLSAVYEGILARLLAGNA 380 + ++IELGP NA+IHQI+E+V DI L +Y + L A A Sbjct: 362 VCPQVIELGPVNASIHQIDEHVAPGDIETLKNIYRRAITTLNAAAA 407 Lambda K H 0.317 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 475 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 407 Length adjustment: 31 Effective length of query: 350 Effective length of database: 376 Effective search space: 131600 Effective search space used: 131600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_038217091.1 Q392_RS28990 (succinyl-diaminopimelate desuccinylase)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.19746.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-144 468.0 0.0 1.5e-144 467.6 0.0 1.2 1 lcl|NCBI__GCF_000745855.1:WP_038217091.1 Q392_RS28990 succinyl-diaminopim Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000745855.1:WP_038217091.1 Q392_RS28990 succinyl-diaminopimelate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 467.6 0.0 1.5e-144 1.5e-144 2 369 .. 5 401 .. 4 402 .. 0.97 Alignments for each domain: == domain 1 score: 467.6 bits; conditional E-value: 1.5e-144 TIGR01246 2 lelakeLisrksvtPndagaqeliaerLkklgfeieilefedt....knlwatrgt............. 53 l+la++Li +svtP+d g+q+li erL +lgf+ e++e + t +nlwa r+ lcl|NCBI__GCF_000745855.1:WP_038217091.1 5 LHLAEQLIATPSVTPEDGGCQQLIGERLARLGFALERIESGPTdfrvTNLWAVRRPgpsaaapapgaai 73 689************************************986422338***999988999********* PP TIGR01246 54 ........eepvlvfaGhtDvvPaGelekWssdpfepeerdGklygrGaaDmkgslaafvvaaerfvkk 114 ++pvlvfaGhtDvvP+G+le+W+s+pf+p++r G lygrGa Dmk+slaafvva e+f+++ lcl|NCBI__GCF_000745855.1:WP_038217091.1 74 patpippvDAPVLVFAGHTDVVPTGPLEQWTSPPFTPTHRGGLLYGRGACDMKSSLAAFVVAIEEFLAA 142 ********************************************************************* PP TIGR01246 115 nadhkGslsllitsDeegeaidGtkkvvetlkerdelidyavvgePssvkklGDvikiGrrGsitgklk 183 ++ + l+ll+tsDeeg +dGt+ v l +r + +d+++vgeP+sv++ GD+ik+GrrG ++g+l+ lcl|NCBI__GCF_000745855.1:WP_038217091.1 143 EPSPRIALALLLTSDEEGPGVDGTVVVCRELAARGQRLDWCIVGEPTSVQRCGDMIKNGRRGTMSGRLT 211 ********************************************************************* PP TIGR01246 184 ikGiqGhvaYPhkaenPvhkavpvlkeliaik....lDeGneffppsslqianieagtgasnviPgelk 248 +G+qGh+aYPh+a+nPvh ++p+l+el+ai+ +D Gn+ff+p+s q++ni+agtgasnviPg + lcl|NCBI__GCF_000745855.1:WP_038217091.1 212 ARGVQGHIAYPHLAKNPVHALAPALAELVAINaeggWDAGNAFFQPTSWQVSNIHAGTGASNVIPGTAV 280 ****************************99866666********************************* PP TIGR01246 249 vkfnlrfssevseeelkskvekildkhkldYelewklsgepfltkegklikkvaeaieevlkkkpelst 317 v fn+rfs+e++ e+l+s+v+ +ld+h+ldYel w++ g pflt+ g l+++v+ ai+e +++++elst lcl|NCBI__GCF_000745855.1:WP_038217091.1 281 VDFNFRFSTESTPESLQSRVQGVLDRHGLDYELAWTVGGLPFLTQPGALVAAVQGAIREETGIETELST 349 ********************************************************************* PP TIGR01246 318 sGGtsDarfiaklgaevvelGlvndtihkvneavkiedleklsevyekllee 369 sGGtsDarfiak+ +v+elG+vn++ih+++e+v d+e l+++y++ ++ lcl|NCBI__GCF_000745855.1:WP_038217091.1 350 SGGTSDARFIAKVCPQVIELGPVNASIHQIDEHVAPGDIETLKNIYRRAITT 401 **********************************************998875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (407 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 7.24 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory