Align Cyclohexadienyl dehydrogenase; Arogenate dehydrogenase; ADH; Prephenate dehydrogenase; PDH; EC 1.3.1.43; EC 1.3.1.12 (characterized)
to candidate WP_039651939.1 PN53_RS02435 prephenate dehydrogenase
Query= SwissProt::Q04983 (293 letters) >NCBI__GCF_000816635.1:WP_039651939.1 Length = 286 Score = 126 bits (317), Expect = 5e-34 Identities = 87/282 (30%), Positives = 148/282 (52%), Gaps = 8/282 (2%) Query: 7 IAIIGLGLIGSSAARATKAYCPDVTVSLYDKSEFVRDRARALNLGDNVTDDIQDAVREAD 66 IA++GLGLIG S A A K+ V + D++ D+A +N+ D + +++ D Sbjct: 11 IAVVGLGLIGGSYAMALKSLNAKHIVGI-DRNLATLDKAIEMNIIDCAYEKPGKFLKDID 69 Query: 67 LVLLCVPVRAMGIVAAAMAPALKKDVIICDTGSVKVSVIKTLQDNLPNHI-IVPSHPLAG 125 +++ + + K V+I DT +K VI++++ LP+ + V HP+AG Sbjct: 70 FIIIALYPKDTIDFVKQNIKYFKSGVLITDTSGIKKIVIESVESVLPDDMEFVSGHPMAG 129 Query: 126 TENNGPDAGFAELFQDHPVILTPDAHTPAQAIAYIADYWEEIGGR-INLMSAEHHDHVLA 184 E G D A +F+D I+TP++ +IA+IA +IG + + +SA+ HD ++A Sbjct: 130 KEYKGIDYADANIFKDANYIITPNSKNKKSSIAFIASMARKIGCKNVEYISADEHDKIIA 189 Query: 185 LTSHLPHVIAYQLIGMVSGYEKKSRTPIMRYSAGSFRDATRVAASEPRLWQDIMLENAPA 244 TS LPHVIA L+ + E K + GSFRDATRVA +LW ++ + N+ Sbjct: 190 YTSQLPHVIAAALMN-ANLQEFKPEL----FVGGSFRDATRVALINSKLWSELFMLNSDK 244 Query: 245 LLPVLDHFIADLKKLRTAIASQDGDYLLEHFKESQKARLALK 286 L+ ++ F L +++ + ++D + L F++S R K Sbjct: 245 LVDTINGFQKVLDRIKNDVLNKDVEDLETVFEKSINLRKRFK 286 Lambda K H 0.321 0.136 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 293 Length of database: 286 Length adjustment: 26 Effective length of query: 267 Effective length of database: 260 Effective search space: 69420 Effective search space used: 69420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory