Align ornithine carbamoyltransferase (EC 2.1.3.3) (characterized)
to candidate WP_040580602.1 A3OQ_RS0105025 ornithine carbamoyltransferase
Query= BRENDA::Q98BB6 (303 letters) >NCBI__GCF_000385335.1:WP_040580602.1 Length = 312 Score = 406 bits (1043), Expect = e-118 Identities = 202/308 (65%), Positives = 239/308 (77%), Gaps = 10/308 (3%) Query: 2 SVRHFTDLSTVSEGDLRFMLDDAVVRKARLKAGERT------RPLEGKVLAMIFDKPSTR 55 + RHF DLS + DLR +LD A AR+KAG R RPL GK+LAMIFDKPSTR Sbjct: 6 TARHFLDLSEIPAPDLRHILDAA----ARIKAGRRKGQIAAERPLAGKMLAMIFDKPSTR 61 Query: 56 TRVSFDVGMRQLGGETIMLTGTEMQLGRSETIADTAKVLSRYVDAIMIRTTSHDRLLELT 115 TRVSFDVGMR+LGGETIMLTG EMQLGR ETIADTA+VLSR+VDA++IR SH + EL Sbjct: 62 TRVSFDVGMRELGGETIMLTGQEMQLGRGETIADTARVLSRFVDAVVIRILSHTDMQELA 121 Query: 116 ENATVPVINGLTDDTHPCQLMADIMTFEEHRGPVAGKTIAWTGDGNNVLHSLLEASARFR 175 ++A++PVINGLT THPCQ+MAD++TFEEHRGP+ G+T+AWTGD NNVL S + A+ RF Sbjct: 122 DHASIPVINGLTKKTHPCQVMADVLTFEEHRGPIKGRTVAWTGDANNVLASWVHAAQRFD 181 Query: 176 FNLNVAVPEGSEPAQKHIDWSKAHGGKLHFTRSPEEAVDQADCVVTDCWVSMGQEHRARG 235 F +NVA P + ++W+K +L+ TR P EAV +AD V++DCWVSMG E Sbjct: 182 FEINVATPAELAMPAELVEWAKRSKTRLNVTRDPFEAVRRADAVISDCWVSMGDEDETFR 241 Query: 236 HNVFSPYQVNAKLMAHAKPDALFMHCLPAHRGEEVTDEVIDGPHSVVFDEAENRLHAQKA 295 HN+ +PYQVNAKLMA A DA+FMHCLPAHRGEEVTDEVIDGP SVVFDEAENRLHAQK Sbjct: 242 HNLLAPYQVNAKLMAAAAKDAIFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKG 301 Query: 296 VLAWCLGA 303 +LAWCLGA Sbjct: 302 ILAWCLGA 309 Lambda K H 0.320 0.133 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 386 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 312 Length adjustment: 27 Effective length of query: 276 Effective length of database: 285 Effective search space: 78660 Effective search space used: 78660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_040580602.1 A3OQ_RS0105025 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00658.hmm # target sequence database: /tmp/gapView.32676.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-115 371.7 0.0 1.5e-115 371.6 0.0 1.0 1 lcl|NCBI__GCF_000385335.1:WP_040580602.1 A3OQ_RS0105025 ornithine carbamo Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000385335.1:WP_040580602.1 A3OQ_RS0105025 ornithine carbamoyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 371.6 0.0 1.5e-115 1.5e-115 1 303 [. 8 307 .. 8 308 .. 0.98 Alignments for each domain: == domain 1 score: 371.6 bits; conditional E-value: 1.5e-115 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgke..ekklkgktlaliFekrstRtRvsfevaayelGaq 67 rh+l+l ++ +l+++l+ a+++k+ ++kg+ e+ l gk la+iF+k+stRtRvsf+v++ elG++ lcl|NCBI__GCF_000385335.1:WP_040580602.1 8 RHFLDLSEIPAPDLRHILDAAARIKAGRRKGQIaaERPLAGKMLAMIFDKPSTRTRVSFDVGMRELGGE 76 8****************************997555899******************************* PP TIGR00658 68 vlylnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDl 136 +++l +e+qlgr+e+i+Dtarvlsr+vda+v+R +h+d++ela++as+PvingLt ++hPcq++aD+ lcl|NCBI__GCF_000385335.1:WP_040580602.1 77 TIMLTGQEMQLGRGETIADTARVLSRFVDAVVIRILSHTDMQELADHASIPVINGLTKKTHPCQVMADV 145 ********************************************************************* PP TIGR00658 137 ltikeklgklkevklvyvGDannvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggkle 205 lt +e+ g +k+ ++++ GDannv s + aa + ++++vatP +l + ae+v++ak ++ ++l+ lcl|NCBI__GCF_000385335.1:WP_040580602.1 146 LTFEEHRGPIKGRTVAWTGDANNVLASWVHAAQRFDFEINVATPAELAMPAELVEWAK----RSKTRLN 210 ********************************************************95....5889*** PP TIGR00658 206 ltedpkkavkdadviytDvwvsmGeeekkeerlkllkpyqvneellelakpevkflhCLPavrGeevtd 274 +t+dp +av+ ad + D wvsmG+e+++ r +ll pyqvn +l++ a ++++f+hCLPa+rGeevtd lcl|NCBI__GCF_000385335.1:WP_040580602.1 211 VTRDPFEAVRRADAVISDCWVSMGDEDET-FRHNLLAPYQVNAKLMAAAAKDAIFMHCLPAHRGEEVTD 278 *************************9987.899************************************ PP TIGR00658 275 evlegeasivfdeaenRlhaqkavlkall 303 ev++g++s+vfdeaenRlhaqk++l+++l lcl|NCBI__GCF_000385335.1:WP_040580602.1 279 EVIDGPQSVVFDEAENRLHAQKGILAWCL 307 *************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (312 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 9.84 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory