Align 3-isopropylmalate/3-methylmalate dehydrogenase; 3-isopropylmalate dehydrogenase; 3-IPM-DH; IMDH; IPMDH; Beta-IPM dehydrogenase; D-malate dehydrogenase [decarboxylating]; EC 1.1.1.85; EC 1.1.1.n5; EC 1.1.1.83 (characterized)
to candidate WP_041097669.1 SUTH_RS05410 NADP-dependent isocitrate dehydrogenase
Query= SwissProt::Q58130 (333 letters) >NCBI__GCF_000828635.1:WP_041097669.1 Length = 409 Score = 160 bits (406), Expect = 4e-44 Identities = 121/374 (32%), Positives = 177/374 (47%), Gaps = 61/374 (16%) Query: 7 IEGDGIGKEVVPATIQVLEAT-------GLPFEFVYAEAGDEVYKRTGKA--LPEETI-- 55 IEGDGIG ++ P +V++A ++ AG++ + G LP ETI Sbjct: 30 IEGDGIGVDITPVMQKVVDAAVQKSYGGKRKISWMEVYAGEKATRLYGPDVWLPAETITA 89 Query: 56 --ETALDCDAVLFGAAGETAADVIVKLRHILDTYANIRPVKAYKGVKCLRPD---IDYVI 110 E ++ L G + V LR +D Y +RPV+ ++G+ D D VI Sbjct: 90 CKEYSVSIKGPLTTPVGGGIRSLNVALRQEMDLYQCVRPVRYFRGIPSPLKDPSKTDMVI 149 Query: 111 VRENTEGLYKGIEAEIDE--------------GIT---------IATRVITEKACERIFR 147 RENTE +Y GIE + + G+T I + ++ + ER+ R Sbjct: 150 FRENTEDIYCGIEWQAESAPARKLIKFLQEEMGVTKIRFPNTSGIGIKPVSREGTERLMR 209 Query: 148 FAFNLARERKKMGKEGKVTCAHKANVLKLTDGLFKKIFYKVAEEY--------------- 192 A N A K+ VT HK N++K T+G F+ Y +A+ Sbjct: 210 AAVNYAIANKRKS----VTIVHKGNIMKYTEGGFRDWAYALAKNEFGGVEIDGGPWLKLP 265 Query: 193 DDIKAEDYYIDAMNMYIITKPQVFDVVVTSNLFGDILSDGAAGTVGGLGLAPSANIGDEH 252 + I +D DA I+ +P +DV+ T NL GD +SD A VGG+G+AP ANI D + Sbjct: 266 NGIVIKDAIADAFLQQILLRPAEYDVIATLNLNGDYISDALAAQVGGIGIAPGANISDLY 325 Query: 253 GLFEPVHGSAPDIAGKKIANPTATILSAVLMLRYLGEYEAADKVEKALEEVLALGLTTPD 312 FE HG+AP AGK NP + ILSA +MLR++G EAAD + K++E + + T D Sbjct: 326 ACFEATHGTAPKYAGKDYVNPGSLILSAEMMLRHMGWVEAADLIIKSMEAAIGDKVVTYD 385 Query: 313 LGGNLNTFEMAEEV 326 E A+EV Sbjct: 386 FA---RLMEGAKEV 396 Lambda K H 0.318 0.138 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 409 Length adjustment: 30 Effective length of query: 303 Effective length of database: 379 Effective search space: 114837 Effective search space used: 114837 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory