Align Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase; EC 2.6.1.118; EC 2.6.1.124 (uncharacterized)
to candidate WP_041097708.1 SUTH_RS05530 aspartate aminotransferase family protein
Query= curated2:Q5JFW3 (362 letters) >NCBI__GCF_000828635.1:WP_041097708.1 Length = 390 Score = 251 bits (640), Expect = 3e-71 Identities = 144/359 (40%), Positives = 208/359 (57%), Gaps = 21/359 (5%) Query: 5 RKRLRLVRGEGVYVWDEKGRRYLDLIAGIGVNVLGHAHPEWVLDMSRQLEKIVVAGPMFE 64 R + G+G ++DE+G+ YLD +AGI VN LGH HP V +S Q+ +++ ++ Sbjct: 10 RLPVAFTHGQGCRLFDEQGKSYLDALAGIAVNTLGHNHPRLVKALSNQVARLIHTSNLYR 69 Query: 65 HDEREEMLEELSHWVDYEYVYMGNSGTEAVEAAIKFARL-----ATGRSEIVAMTNAFHG 119 E E + L+ + V+ NSG EA EAAIK AR+ + I+ M +AFHG Sbjct: 70 ISEAEAASDRLAALSGMDEVFFCNSGCEANEAAIKLARMYGHQQGVEQPAIIVMEHAFHG 129 Query: 120 RTLGSLSATWKKKYREGFGPLVPGFKHIPFNNVEAAKEAITK--ETAAVIFEPIQGEGGI 177 RTL +LSAT +K + GF PLV GF +PF+++ A ++ + AV+FEPIQGEGGI Sbjct: 130 RTLATLSATGNRKVQAGFEPLVSGFVRVPFDDLAAIEQLAERNPNVVAVLFEPIQGEGGI 189 Query: 178 VPADEEFVKTLRDLTEDVGALLIADEVQSGL-RTGKFLAIEHYGVRPDIVTMGKGIGNGF 236 A +F++ LR + + L + DEVQ G+ RTG + A +H G+ PD++T+ KG+G+G Sbjct: 190 NLAHNDFMRALRKICDRKNWLFMVDEVQCGIGRTGVWFAHQHAGILPDVMTLAKGLGSGV 249 Query: 237 PVSLTLTDLE----IPRGKHGSTFGGNPLACRAVATTLRILRRDRLVEKA---------G 283 P+ L G HGSTFGGNPLAC A TTL ++ D L+ +A G Sbjct: 250 PIGACLAAGRAAGVFKPGNHGSTFGGNPLACVAALTTLDVVEADGLMARATMLGETIRGG 309 Query: 284 EKFMEFSGERVVKTRGRGLMIGIVLRRPAGNYVKALQERGILVNTAGNRVIRLLPPLII 342 + V+ RG GLMIGI L RP G+ V+ E G+L+N ++V+RLLP L++ Sbjct: 310 LRSGLAGTSGFVEVRGDGLMIGIELDRPCGDLVRRGLESGLLINVTADKVVRLLPALVM 368 Lambda K H 0.320 0.140 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 24 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 390 Length adjustment: 30 Effective length of query: 332 Effective length of database: 360 Effective search space: 119520 Effective search space used: 119520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory