Align δ1-pyrroline-5-carboxylate synthetase (EC 1.2.1.41; EC 2.7.2.11) (characterized)
to candidate WP_041100688.1 SUTH_RS16085 glutamate-5-semialdehyde dehydrogenase
Query= metacyc::AT2G39800-MONOMER (717 letters) >NCBI__GCF_000828635.1:WP_041100688.1 Length = 418 Score = 271 bits (694), Expect = 4e-77 Identities = 151/408 (37%), Positives = 236/408 (57%), Gaps = 15/408 (3%) Query: 302 ARESSRKLQALSSEDRKKILLDIADALEANVTTIKAENELDVASAQEAGLEESMVARLVM 361 ARE+SR S+ + LL +A A+ + A N DVA A+ GL+ +M+ RL + Sbjct: 14 AREASRATARASTAAKNTALLAMAQAIRERRDELLAANAADVADARNNGLDAAMIDRLTL 73 Query: 362 TPGKISSLAASVRKLADMEDPIGRVLKKTEVADGLVLEKTSSPLGVLLIVFESRPDALVQ 421 T + ++A + ++A + DPIG + G+ + K PLGV+ I++E+RP+ Sbjct: 74 TEKSVEAMAQGLEQVAALPDPIGEITDMKRRPSGIQVGKMRVPLGVVGIIYEARPNVTAD 133 Query: 422 IASLAIRSGNGLLLKGGKEARRSNAILHKVI-----TDAIPETVGGKLIGLVTSREEIPD 476 A+L ++SGN +L+GGKE+ R+N + + +PET + T R + Sbjct: 134 AAALCLKSGNAAILRGGKESLRANQAIAACVRAGLKAAGLPETAVQVIE--TTDRAAVGH 191 Query: 477 LLKLDDVIDLVIPRGSNKLVTQIKNTTKIPVLGHADGICHVYVDKACDTDMAKRIVSDAK 536 L+ + + +D+++PRG L+ +I ++PV+ H DG CHVYVD A D A RI+ ++K Sbjct: 192 LVAMPEYVDVIVPRGGKGLIERISKEARVPVIKHLDGNCHVYVDDAADAGKALRILENSK 251 Query: 537 LDYPAACNAMETLLVHKDLEQNAVLNELIFALQSNGVTLYGGPRASKILNIPEA-----R 591 CN E+LL+ + + + + L L +GV + G K+ +P+A Sbjct: 252 TQRLGTCNTAESLLIARPVAVS-LAPTLCAMLGRHGVAIRGCEETRKL--VPQAIAATEE 308 Query: 592 SFNHEYCAKACTVEVVEDVYGAIDHIHRHGSAHTDCIVTEDHEVAELFLRQVDSAAVFHN 651 + EY A +V++V DV AI+HI+ + S HTD IVTE++ A FLR+VDS +V N Sbjct: 309 DWYAEYLAAIISVKIVADVGEAIEHINTYSSQHTDTIVTENYTNAMRFLREVDSGSVMVN 368 Query: 652 ASTRFSDGFRFGLGAEVGVSTGRIHARGPVGVEGLLTTRWIMRGKGQV 699 ASTRF+DGF +GLGAE+G+ST + HARGPVG+EGL + +WI+ G G+V Sbjct: 369 ASTRFADGFEYGLGAEIGISTDKFHARGPVGLEGLTSQKWIVLGDGEV 416 Lambda K H 0.318 0.135 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 568 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 717 Length of database: 418 Length adjustment: 36 Effective length of query: 681 Effective length of database: 382 Effective search space: 260142 Effective search space used: 260142 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory