Align Cystathionine beta-lyase PatB; CBL; Beta-cystathionase PatB; Cysteine lyase PatB; Cysteine-S-conjugate beta-lyase PatB; EC 4.4.1.13 (characterized)
to candidate WP_041101173.1 SUTH_RS17800 putative C-S lyase
Query= SwissProt::Q08432 (387 letters) >NCBI__GCF_000828635.1:WP_041101173.1 Length = 392 Score = 237 bits (605), Expect = 4e-67 Identities = 139/393 (35%), Positives = 210/393 (53%), Gaps = 12/393 (3%) Query: 2 NFDKREERLGTQSVKWDK----TGELFGVTDALPMWVADMDFRAPEAITEALKERLDHGI 57 +FD +R T SVKW K G V D +P+WVADMDF AP + AL++R+DHG+ Sbjct: 4 DFDAVLDRANTDSVKWAKYAAGQGPNEAVRDVIPLWVADMDFAAPPPVISALRQRIDHGV 63 Query: 58 FGYTTPDQKTKDAVCGWMQNRHGWKVNPESITFSPGVVTALSMAVQAFTEPGDQVVVQPP 117 FGY P + DAV G++ W ++PE + + PG+V+ L++A +A GD P Sbjct: 64 FGYNQPTRSQIDAVVGYVARTFDWTIDPEWLVWLPGLVSGLNVACRAVGTAGDAAFTATP 123 Query: 118 VYTPFYHMVEKNGRHILHNPLLEKDGAYAIDFEDLETKLSDPSVTLFILCNPHNPSGRSW 177 +Y PF + +GR + PL+ + DF ++ L LF+LC+PHNP+GR W Sbjct: 124 IYPPFLSAPKFSGRRVASAPLVRDSAGWLWDFPTVDAVLKSSQAKLFLLCHPHNPTGRVW 183 Query: 178 SREDLLKLGELCLEHGVTVVSDEIHSDLMLY-GHKHTPFASLSDDFADISVTCAAPSKTF 236 + ++L ++ L +H + V SDEIH+ L+L +H FA+LS + A ++T APSKTF Sbjct: 184 NDDELWQIALLAEKHDLVVCSDEIHNGLILSPSRRHRLFATLSPELAARTITLMAPSKTF 243 Query: 237 NIAGLQASAIIIPD-RLKRAKFSASLQRNGLGGLNAFAVTAIEAAYSKGGPWLDELITYI 295 NI GL + +IPD RL+RA A + +NA + A EAA + W L+ Y+ Sbjct: 244 NIPGLGCAFAVIPDSRLRRAFREA--MHGIVPHVNALGMVANEAALTLCDDWHAALLDYL 301 Query: 296 EKNMNEAEAFLSTELPKVKMMKPDASYLIWLDFSAYGLS-DAELQQRMLKKGKVILEPGT 354 N+ E ++ P + M +A+YL W+D + + R ++ + L G Sbjct: 302 RGNLRAVERAVAA-TPGLDMRPVEATYLAWIDAREFAADRGIDNPARWFERHGLGLSDGA 360 Query: 355 KYGPGGEGFMRLNAGCSLATLQDGLRRIKAALS 387 + G GF+RLN G A L + L R+ A S Sbjct: 361 DF--GAPGFVRLNFGTRRALLDEALVRLSRAAS 391 Lambda K H 0.318 0.135 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 432 Number of extensions: 22 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 392 Length adjustment: 30 Effective length of query: 357 Effective length of database: 362 Effective search space: 129234 Effective search space used: 129234 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory