Align LL-diaminopimelate aminotransferase; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; EC 2.6.1.83 (uncharacterized)
to candidate WP_041101994.1 SUTH_RS08365 succinyldiaminopimelate transaminase
Query= curated2:C6BUK3 (388 letters) >NCBI__GCF_000828635.1:WP_041101994.1 Length = 397 Score = 161 bits (408), Expect = 3e-44 Identities = 124/393 (31%), Positives = 186/393 (47%), Gaps = 22/393 (5%) Query: 10 LATLPPYLFAEIDRLKAEVA-AQGVDIISLGIGDPDLPTPDFIIEALHKAAKNPVNHQYP 68 LA L PY F ++ +L A V A + I L IG+P TP FI AL N YP Sbjct: 5 LALLQPYPFEKLRQLFAGVPPAPTLGEIKLSIGEPQHATPPFIQRALADNLAGLAN--YP 62 Query: 69 SYVGLLTFRQAVADWYKERFDVEL-DATKEVVSLIGSKEGIAHFPLAFVN-PGDLVLVAS 126 + G RQ +A W R+ V DA +V+ + GS+E + F ++ G V Sbjct: 63 TTQGADALRQTIAAWIARRYGVAPPDAATQVLPVNGSREALFAFAQTVIDRSGGHAKVVC 122 Query: 127 PN--YPVYPVASGFAGGEVEIVPLLEENDFLPNLDAISDEKWDKCKIFFVNYPNNPTSAT 184 PN Y +Y A+ AG + + L F + A+ + W ++ +V P NPT Sbjct: 123 PNPFYQIYEGAALLAGAQPIYLNTLPHTHFEMDWAALPESAWRDVQLVYVCSPANPTGKV 182 Query: 185 ATPEFYAELVAKAKKHNVIIAADAAYTEVYYDEDKKPISILETP-----GAKDVAIEFHS 239 T + + L + +H +IA+D Y+E+Y+DE K P+ L G + F S Sbjct: 183 MTLDSWKALFELSDRHGFVIASDECYSEIYFDEAKPPLGGLTAAAQLGRGDYRNLVMFSS 242 Query: 240 LSKTYNMTGWRCGMAVGNASLVAGLGKIKENVDSGIFQAVQEAGIVALKEGEPYVKEFRK 299 LSK N+ G R G G+AS+V + S + AVQ A I A + E +V++ R+ Sbjct: 243 LSKRSNVPGLRSGFVAGDASIVKKFLLYRTYHGSAMNPAVQAASIAAWND-EAHVRDNRR 301 Query: 300 IYKERRDCVIEALEKINISCKVPDASIFVWAKTPEGYTSSEFVSKLLKETGVVVTPGNGF 359 +Y E+ V + ++ C+VPDA ++WAKTP +EF +LL+ VVV PG+ Sbjct: 302 MYAEKFHEVTPLIAH-HLDCRVPDAGFYLWAKTP--IADTEFARELLRRKNVVVLPGSYL 358 Query: 360 GESGEG------YFRISLTVDTDRLKEAVSRIS 386 G + RI+L + EA RI+ Sbjct: 359 AREANGINPGADFIRIALVAPHEECLEAARRIN 391 Lambda K H 0.317 0.136 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 408 Number of extensions: 22 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 397 Length adjustment: 31 Effective length of query: 357 Effective length of database: 366 Effective search space: 130662 Effective search space used: 130662 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory