Align glutamate N-acetyltransferase/amino-acid acetyltransferase; EC 2.3.1.35 2.3.1.1 (characterized)
to candidate WP_041102425.1 SUTH_RS15125 bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ
Query= CharProtDB::CH_000559 (406 letters) >NCBI__GCF_000828635.1:WP_041102425.1 Length = 412 Score = 424 bits (1091), Expect = e-123 Identities = 234/414 (56%), Positives = 286/414 (69%), Gaps = 10/414 (2%) Query: 1 MAVNLTEKTAEQLPDIDGIALYTAQAGVKKPGHTDLTLIAVAAGSTVGAVFTTNRFCAAP 60 M VN E L + G+ L TA+AG++K DLTLI A GS VFT NR CAAP Sbjct: 1 MPVNYATPAPEALFPVAGVRLGTAEAGIRKKNRRDLTLIEFAPGSRAAGVFTQNRCCAAP 60 Query: 61 VHIAKSHLFDEDGVRALVINTGNANAGTGAQGRIDALAVCAAAARQIGCKPNQVMPFSTG 120 V + + HL + +RALVINTG ANA TG QG A C A A+ +GC ++V+PFSTG Sbjct: 61 VTLCREHLAGDSSIRALVINTGIANAATGEQGMRAARDTCDAVAKLLGCAADEVLPFSTG 120 Query: 121 VILEPLPADKIIAALP----KMQPAFWNEAARAIMTTDTVPKAASREGKVGDQHTVRATG 176 VILE LP +++IA LP + W+ AA AIMTTDTV KAASR D +++ TG Sbjct: 121 VILEHLPVERLIAGLPAARADLAADHWHAAAHAIMTTDTVAKAASRRVASAD-YSIVVTG 179 Query: 177 IAKGSGMIHPNMATMLGFIATDAKVSQPVLQLMTQEIADETFNTITVDGDTSTNDSFVII 236 I+KG+GMI PNMATMLGF+ATDA +S +LQ + ++ AD +FN ITVDGDTSTNDSFV+I Sbjct: 180 ISKGAGMIRPNMATMLGFVATDAGLSPALLQKLAKDAADASFNCITVDGDTSTNDSFVVI 239 Query: 237 ATGKNSQSEIDNIADPRYAQLKELLCSLALELAQAIVRDGEGATKFITVRVENAKTCDEA 296 ATG S IDN + P + L++ + +A ELAQAIVRDGEGATKFITV+V T E Sbjct: 240 ATGV-SGCMIDNESSPHWPALRDAVIGVATELAQAIVRDGEGATKFITVKVGAGGTAAEC 298 Query: 297 RQAAYAAARSPLVKTAFFASDPNLGKRLAAIGYADVADLDTDLVEMYL----DDILVAEH 352 RQ AYA SPLVKTAFFASDPNLG+ LAAIGYA +ADLD V ++L +++LV+E+ Sbjct: 299 RQVAYAIGHSPLVKTAFFASDPNLGRILAAIGYAGIADLDAAGVRVWLGSGSEEVLVSEN 358 Query: 353 GGRAASYTEAQGQAVMSKDEITVRIKLHRGQAAATVYTCDLSHGYVSINADYRS 406 GGRAASY E G +M EITVR+ L RG A ATV+TCDLS+ YV INADYRS Sbjct: 359 GGRAASYREDDGARIMQAAEITVRVDLGRGSAEATVWTCDLSYDYVKINADYRS 412 Lambda K H 0.317 0.130 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 437 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 412 Length adjustment: 31 Effective length of query: 375 Effective length of database: 381 Effective search space: 142875 Effective search space used: 142875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory