Align isopropylmalate/citramalate isomerase large subunit LeuC (EC 4.2.1.33; EC 4.2.1.35) (characterized)
to candidate WP_041275329.1 DESRU_RS06680 3-isopropylmalate dehydratase large subunit
Query= reanno::DvH:208495 (419 letters) >NCBI__GCF_000215085.1:WP_041275329.1 Length = 428 Score = 400 bits (1028), Expect = e-116 Identities = 211/416 (50%), Positives = 274/416 (65%), Gaps = 3/416 (0%) Query: 1 MAHTLAQKILQRHTDEAITDAGQIVRCRVSMVLANDITAPLAIKSFRAMGAKRVFDKDRV 60 + T+ +KIL H+ + T AG IV +V V+ D T+PLAI++F M K +F+ D+V Sbjct: 11 LGKTIIEKILSAHSGQECT-AGDIVVAQVDFVMGQDGTSPLAIRAFENMDGKELFNPDKV 69 Query: 61 ALVMDHFTPQKDIEAAQQVKLTREFAREMGVTHYYEGGDCGVEHALLPELGLVGPGDVVV 120 ALV+DH +P + KL REFA+ G Y G GV H L+PE G VGPG +V+ Sbjct: 70 ALVIDHSSPSPLEGVSALHKLMREFAKSKGCRMYDIGE--GVCHQLIPESGKVGPGSLVI 127 Query: 121 GADSHTCTYGGLGAFATGLGSTDVAGAMALGETWFKVPPTIRATFTGTLPAYVGAKDLIL 180 GADSHTCTYG L AF+TG+GSTD+AG + G+ WFKVP T++ GTLP + AKDLIL Sbjct: 128 GADSHTCTYGALNAFSTGVGSTDLAGGLISGKMWFKVPETVKFVCNGTLPKGIYAKDLIL 187 Query: 181 TLIGAIGVDGALYRALEFDGAAIEALDVEGRMTMANMAIEAGGKAGLFAADAKTLTYCTT 240 L+G + DG Y A E+ G AI L +EGR T++NMAIE G KAGL AD KT + Sbjct: 188 YLMGQVTADGCTYMAAEYTGEAITDLSMEGRFTVSNMAIEMGAKAGLMEADHKTFEWLKQ 247 Query: 241 AGRTGDTAFSADAGAVYERELSFDVTGMTPVVACPHLPDNVKPVSEVKDVTVQQVVIGSC 300 A ++D A Y+R L FDV+ + P VA PH DNV P+SEV VQQ VIG+C Sbjct: 248 HTDRQFQAVASDPDARYQRVLEFDVSQLEPQVAKPHRVDNVSPISEVLGTPVQQAVIGTC 307 Query: 301 TNGRIGDLREAAAVLRGRKVSRDVRCIVLPATPGIWRQALREGLIETFMEAGCIVGPATC 360 TNGR+ DLR AA++L G+K+ DVR IV PA+ I+ A+ EG ++ +EAG V C Sbjct: 308 TNGRLEDLRIAASILEGKKIHSDVRLIVAPASRKIYLDAMNEGTLQKLVEAGAAVVTPGC 367 Query: 361 GPCLGGHMGILADGERAIATTNRNFKGRMGSLESEVYLSGPATAAASAVTGVITDP 416 GPC+G H G+ +DGE+ I+T NRNFKGRMG+ +E+YL+ PAT AASA+TGVITDP Sbjct: 368 GPCVGTHNGVPSDGEKVISTANRNFKGRMGNSNAEIYLASPATVAASALTGVITDP 423 Lambda K H 0.320 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 488 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 419 Length of database: 428 Length adjustment: 32 Effective length of query: 387 Effective length of database: 396 Effective search space: 153252 Effective search space used: 153252 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_041275329.1 DESRU_RS06680 (3-isopropylmalate dehydratase large subunit)
to HMM TIGR02086 (3-isopropylmalate dehydratase, large subunit)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR02086.hmm # target sequence database: /tmp/gapView.18578.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02086 [M=411] Accession: TIGR02086 Description: IPMI_arch: 3-isopropylmalate dehydratase, large subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-174 567.0 0.3 1.2e-174 566.8 0.3 1.0 1 lcl|NCBI__GCF_000215085.1:WP_041275329.1 DESRU_RS06680 3-isopropylmalate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000215085.1:WP_041275329.1 DESRU_RS06680 3-isopropylmalate dehydratase large subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 566.8 0.3 1.2e-174 1.2e-174 1 411 [] 13 425 .. 13 425 .. 0.99 Alignments for each domain: == domain 1 score: 566.8 bits; conditional E-value: 1.2e-174 TIGR02086 1 ktlaekilsekvGkevkaGeivevkvDlvmvhDgtgplvikalrelg.akvekkekivlvfDhvvPapt 68 kt++ekils+++G+e +aG+iv+++vD vm +Dgt+pl+i+a++++ ++ ++++k+ lv+Dh++P+p lcl|NCBI__GCF_000215085.1:WP_041275329.1 13 KTIIEKILSAHSGQECTAGDIVVAQVDFVMGQDGTSPLAIRAFENMDgKELFNPDKVALVIDHSSPSPL 81 589*******************************************98999****************** PP TIGR02086 69 veaaelqkeirefakelgikvfdvgeGichqvlvekgyakpgkvvvgaDshtttsGalgafatGlGatD 137 ++ l+k +refak +g + +d+geG+chq++ e g + pg +v+gaDsht+t+Gal af+tG+G+tD lcl|NCBI__GCF_000215085.1:WP_041275329.1 82 EGVSALHKLMREFAKSKGCRMYDIGEGVCHQLIPESGKVGPGSLVIGADSHTCTYGALNAFSTGVGSTD 150 ********************************************************************* PP TIGR02086 138 valalatGktWlkvPesikveleGkleekvtakDvileivkelgadgatykaieftgeeiealsldeRl 206 +a l++Gk+W+kvPe++k + +G l + ++akD+il ++++++adg ty+a e+tge i ls+++R+ lcl|NCBI__GCF_000215085.1:WP_041275329.1 151 LAGGLISGKMWFKVPETVKFVCNGTLPKGIYAKDLILYLMGQVTADGCTYMAAEYTGEAITDLSMEGRF 219 ********************************************************************* PP TIGR02086 207 tlsnlaveagakaglvepdeetleylkkrrge.frilkadedakyeeeieidlseleplvavPhsvdnv 274 t+sn+a+e+gakagl+e+d++t e+lk+++ + f+ + +d+da+y+ +e+d+s+lep+va+Ph+vdnv lcl|NCBI__GCF_000215085.1:WP_041275329.1 220 TVSNMAIEMGAKAGLMEADHKTFEWLKQHTDRqFQAVASDPDARYQRVLEFDVSQLEPQVAKPHRVDNV 288 ***************************9998779*********************************** PP TIGR02086 275 keveevegteidqvfiGsCtnGRledlkiaaeilegrevhkdvrlivvPasrkvyekaleeGlietlve 343 +++ev gt ++q+ iG+CtnGRledl+iaa ileg++ h dvrliv+Pasrk+y +a++eG++++lve lcl|NCBI__GCF_000215085.1:WP_041275329.1 289 SPISEVLGTPVQQAVIGTCTNGRLEDLRIAASILEGKKIHSDVRLIVAPASRKIYLDAMNEGTLQKLVE 357 ********************************************************************* PP TIGR02086 344 aGaiiltpgCGPClGahlGvladgevivsttnRnfkGRmGspkaeiYLasPavaavsaveGeitdpee 411 aGa+++tpgCGPC+G+h Gv +dge ++st+nRnfkGRmG+ +aeiYLasPa++a+sa++G+itdp++ lcl|NCBI__GCF_000215085.1:WP_041275329.1 358 AGAAVVTPGCGPCVGTHNGVPSDGEKVISTANRNFKGRMGNSNAEIYLASPATVAASALTGVITDPRQ 425 ******************************************************************86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (411 nodes) Target sequences: 1 (428 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 7.85 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory