Align arogenate dehydratase (EC 4.2.1.91) (characterized)
to candidate WP_041303735.1 BTUS_RS04750 prephenate dehydratase
Query= BRENDA::Q9SSE7 (381 letters) >NCBI__GCF_000092905.1:WP_041303735.1 Length = 293 Score = 147 bits (370), Expect = 5e-40 Identities = 107/299 (35%), Positives = 155/299 (51%), Gaps = 29/299 (9%) Query: 97 SRVRVAYQGVRGAYSESAAE-------KAYPNCEAVPCEEFDTAFEAVERWLVDRAVLPI 149 ++ ++A+ G G ++E AA P E V C+ + V+PI Sbjct: 3 AQTQLAFLGPSGTFTEEAARVMSGVLASDLPGEEWVACDTIADVLDLTASGATAFGVVPI 62 Query: 150 ENSLGGSIHRNYDLLLRHN-LHIVGEVKLAVRHCLLANHGVNIEDLRRVLSHPQALAQCE 208 ENSL GS++ D L L I E L V H LLA GV+ E + ++SHPQALAQC Sbjct: 63 ENSLEGSVNITLDWLAHEGGLVIAAEAALPVSHHLLARPGVSGEQIEGIVSHPQALAQCR 122 Query: 209 NTLTKL--GLVREAVDDTAGAAKQIAFENLNDAAAVASEKAAKIYGLNIVAKDIQDDCDN 266 L G+ + A + TA AA+++ + D AA+ + AA+IYGL I+A +IQD+ +N Sbjct: 123 GYLRNHFPGVPQYAAESTAAAAERV-IRDPEDLAAIGTRLAARIYGLEILASEIQDEANN 181 Query: 267 VTRFLMLAREP-IIPGTNRLF-------KTSIVFSL-EEGPGVLFKALAVFALRQINLTK 317 TRF+++A + R F KTS + +L E+ PG L++ LA FA ++NLT+ Sbjct: 182 RTRFVLVAAQSRWTEEQQREFCRRHGASKTSALITLGEDHPGALYEVLACFARERVNLTR 241 Query: 318 IESRPLRKHPLRASGGLKYFDYLFYVDFEASMADEVAQNALRHLEEFATFLRVLGSYPV 376 IESRP R+ GL Y F+VD E D A+ + E +R LG+YPV Sbjct: 242 IESRPTRR-------GLG--SYHFFVDMEGQWWDPAVIRAVEGIHETGAAVRDLGTYPV 291 Lambda K H 0.319 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 11 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 293 Length adjustment: 28 Effective length of query: 353 Effective length of database: 265 Effective search space: 93545 Effective search space used: 93545 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory