Align Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase; EC 2.6.1.118; EC 2.6.1.124 (uncharacterized)
to candidate WP_041304058.1 BTUS_RS09720 ornithine--oxo-acid transaminase
Query= curated2:Q5JFW3 (362 letters) >NCBI__GCF_000092905.1:WP_041304058.1 Length = 394 Score = 238 bits (606), Expect = 3e-67 Identities = 135/369 (36%), Positives = 207/369 (56%), Gaps = 21/369 (5%) Query: 10 LVRGEGVYVWDEKGRRYLDLIAGIGVNVLGHAHPEWVLDMSRQLEKIVVAGPMFEHDERE 69 L +GEGV+V D +GRRYLD+++ GH HP + + Q ++I + F +D+ Sbjct: 20 LTKGEGVWVEDVEGRRYLDMLSAYSALNQGHRHPRIIQALKAQADRITLTSRAFYNDKLG 79 Query: 70 EMLEELSHWVDYEYVYMGNSGTEAVEAAIKFAR--------LATGRSEIVAMTNAFHGRT 121 E L+ + + N+GTEAVE AIK R + ++EI+ T FHGRT Sbjct: 80 FFYERLAQLTHKDTILPMNTGTEAVETAIKAMRRWAYRVRGVPEDQAEIIVATGNFHGRT 139 Query: 122 LGSLSATWKKKYREGFGPLVPGFKHIPFNNVEAAKEAITKETAAVIFEPIQGEGGIVPAD 181 +S + + +YREGFGPL PGF+ +P+ ++EA + A TA V+ EPIQGE GIV Sbjct: 140 TTVISFSSEPEYREGFGPLTPGFRVVPYGDIEALRRAAGPHTAGVLLEPIQGEAGIVLPP 199 Query: 182 EEFVKTLRDLTEDVGALLIADEVQSGL-RTGKFLAIEHYGVRPDIVTMGKGIGNG-FPVS 239 + +++ +R + + G + ADE+Q+GL RTG++ A + V PD+ +GK +G G +PVS Sbjct: 200 DGYLREVRRICTENGIVFAADEIQTGLGRTGQWFACDWENVTPDLYILGKALGGGVYPVS 259 Query: 240 LTLTDLEI----PRGKHGSTFGGNPLACRAVATTLRILRRDRLVEKAGE-------KFME 288 + +I G HGSTFGGNPLA T L+++ ++LV+++ E + Sbjct: 260 AVAANRDILGVFEPGSHGSTFGGNPLAAAVAVTALQVIEDEKLVDRSRELGAYFLVRLRT 319 Query: 289 FSGERVVKTRGRGLMIGIVLRRPAGNYVKALQERGILVNTAGNRVIRLLPPLIIEGDTLE 348 + + RGRGL IG+ L PA Y + L+ RG+L IR PPL+I+ + L+ Sbjct: 320 LRHPAIREVRGRGLFIGLELTSPARPYCEKLKNRGLLCKETHETTIRFAPPLVIQKEELD 379 Query: 349 EARKEIEGV 357 A ++I V Sbjct: 380 WAFEQIAEV 388 Lambda K H 0.320 0.140 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 387 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 394 Length adjustment: 30 Effective length of query: 332 Effective length of database: 364 Effective search space: 120848 Effective search space used: 120848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory