Align Alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial; Beta-alanine-pyruvate aminotransferase 1; EC 2.6.1.44 (characterized)
to candidate WP_041313637.1 HM1_RS08735 aspartate aminotransferase family protein
Query= SwissProt::Q940M2 (476 letters) >NCBI__GCF_000019165.1:WP_041313637.1 Length = 413 Score = 206 bits (524), Expect = 1e-57 Identities = 136/376 (36%), Positives = 197/376 (52%), Gaps = 34/376 (9%) Query: 88 YLYDESGRRYLDAFAGIVTVSCGHCHPDILNAITEQSKLLQHATTIYLHHAIGDFAEALA 147 ++YDE GR Y+D +S GH HP I+ +I EQ L + L A AEALA Sbjct: 36 FVYDEQGREYIDFLGNFGVLSLGHRHPRIIASILEQLNGLAQTSRFLLDKATASLAEALA 95 Query: 148 AKMPGNLKVVYFVNSGSEANELAMMMARLYTGSLEMISLRNAYHGGSSNTIGLTALNTWK 207 PG+L+ +F NSG+EA E A+ +ARL TG I+ N +HG + + ++ ++ Sbjct: 96 GITPGDLQYCFFCNSGAEAVEAAIKIARLATGKSGFIATINGFHGKTFGALSVSGREPFR 155 Query: 208 YP-LPQGEIHHVVNPDPYRGVFGSDGSL---YAKDVHDHIEYGTSGKVAGFIAETIQGVG 263 P LP + P FG +L A+D H +A FI E +QG G Sbjct: 156 APFLP-------LLPRVIHVPFGDAAALEEVMARDRH----------IAAFIVEPVQGEG 198 Query: 264 GAVELAPGYLKSVYEIVRNAGGVCIADEVQTGFGRTGSHYWGFQTQDVVPDIVTMAKGIG 323 G + GYLK V + R AG + IADEVQTG GRTGS + + +VPD++ +AK +G Sbjct: 199 GVIVPPRGYLKEVEALCRQAGVLLIADEVQTGLGRTGS-LFACDEEGLVPDLLCLAKALG 257 Query: 324 NG-LPLGAVVTTPEIASVLASK--ILFNTFGGNPVCSAGGLAVLNVIDKEKRQEHCAEVG 380 G +P+GAVV P + + L + +TFGGNP+ A LA + V +E + G Sbjct: 258 GGVMPIGAVVGRPALWAPLFDHPWLHTSTFGGNPLACAAALAAIEVTIEEDLMGQARQKG 317 Query: 381 SHLIQRLKDVQKRHD-IIGDVRGRGLMVGIELVSDRKDKTPAKAETSVLFEQLRELGILV 439 L+ RLK++ RH+ +I DVRGRGL++GIEL + + ++ E I+V Sbjct: 318 DWLLSRLKELASRHEQVIADVRGRGLLIGIELTKE--------GVGGFVIGRMMEERIIV 369 Query: 440 GKGGLHGNVFRIKPPM 455 G H V R++PP+ Sbjct: 370 GYTLNHPRVIRLEPPL 385 Lambda K H 0.320 0.138 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 475 Number of extensions: 26 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 476 Length of database: 413 Length adjustment: 32 Effective length of query: 444 Effective length of database: 381 Effective search space: 169164 Effective search space used: 169164 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory