Align Methanogen homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.114 (characterized)
to candidate WP_041314963.1 HM1_RS06900 3-isopropylmalate dehydratase small subunit
Query= SwissProt::Q58667 (170 letters) >NCBI__GCF_000019165.1:WP_041314963.1 Length = 167 Score = 162 bits (410), Expect = 3e-45 Identities = 85/162 (52%), Positives = 108/162 (66%), Gaps = 4/162 (2%) Query: 1 MIIKGRAHKFGDDVDTDAIIPGPYLRTTDPYELASHCMAGIDENFPKKVKEGDVIVAGEN 60 M GR KFG D+DTDAIIP YL TT P ELA HCM D +FP+KV++GD+IVA +N Sbjct: 2 MEFTGRVWKFGKDIDTDAIIPARYLNTTSPEELAKHCMEDADPSFPQKVRKGDIIVADKN 61 Query: 61 FGCGSSREQAVIAIKYCGIKAVIAKSFARIFYRNAINVGLIPII---ANTDEIKDGDIVE 117 FGCGSSRE A IAIK G+ VIAKSFARIF+RNAIN+GL PI D I++GD+V+ Sbjct: 62 FGCGSSREHAPIAIKAAGVPCVIAKSFARIFFRNAINIGL-PIFECPEAVDGIREGDVVQ 120 Query: 118 IDLDKEEIVITNKNKTIKCETPKGLEREILAAGGLVNYLKKR 159 ++ D+ I +T + + I+ AGGL+ Y+K R Sbjct: 121 VNADRGVIFNMTTGQTYTAKALPASMQSIIQAGGLMQYVKTR 162 Lambda K H 0.318 0.139 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 122 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 170 Length of database: 167 Length adjustment: 18 Effective length of query: 152 Effective length of database: 149 Effective search space: 22648 Effective search space used: 22648 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory