Align aspartate-prephenate aminotransferase (EC 2.6.1.78) (characterized)
to candidate WP_041315020.1 HM1_RS07415 pyridoxal phosphate-dependent aminotransferase
Query= BRENDA::Q56232 (385 letters) >NCBI__GCF_000019165.1:WP_041315020.1 Length = 396 Score = 179 bits (453), Expect = 2e-49 Identities = 115/352 (32%), Positives = 184/352 (52%), Gaps = 16/352 (4%) Query: 37 TAGEPDFDTPEHVKEAARRALAQ---GKTKYAPPAGIPELREALAEKFRRENGLSVTPEE 93 T G P+ + P +EA + G +Y AG PE R+A+A+ +G ++T + Sbjct: 40 TIGNPNNEPPAAFREALLELASHPVPGMHRYMSNAGYPETRQAVADALSTASGKALTADH 99 Query: 94 TIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPD 153 ++TVG L +F+ ILDPGDEVI+ +P++V Y + GG V V++ +E F D Sbjct: 100 VVMTVGAGGGLNVVFKTILDPGDEVIISAPFFVEYKGYLANHGGKAVIVQS--KEDFQLD 157 Query: 154 PERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARL------AVEHDFYLVSDEIYE 207 + + A+T +T+A+++NSPNNPTG VYP + L+AL RL ++VSDE Y Sbjct: 158 LDAIAAAVTAKTRAVIINSPNNPTGVVYPADSLDALNRLLEAKGAEFGRTLFVVSDEPYA 217 Query: 208 HLLYEGEHFSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSP 267 ++Y+G P +++ V +K A+ G RIGY E+ + A + Sbjct: 218 KIVYDGVTVPPVFAHIRNSIVVTSHSKDLALPGERIGYIAISPEIEE--APLLFDGLVLA 275 Query: 268 DTIAQWATLEALTNQ-EASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMD 326 + I + AL + A + + YR +RDL + LTA+G + V+P GAFY L Sbjct: 276 NRILGFVNAPALMQRLVAKLQNASVNIDEYREKRDLFYDNLTAMGYEMVKPQGAFY-LFP 334 Query: 327 TSPIAPDEVRAAERLLEAGVAVVPGTDFAAFGHVRLSYATSEENLRKALERF 378 SP+A D+V R + + +VPG+ F G+ R++Y + + +LE F Sbjct: 335 KSPLA-DDVEFVRRAQKYNILLVPGSGFGKPGYFRIAYCVEKRIIENSLEAF 385 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 360 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 396 Length adjustment: 31 Effective length of query: 354 Effective length of database: 365 Effective search space: 129210 Effective search space used: 129210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory