Align branched-chain-amino-acid aminotransferase; EC 2.6.1.42 (characterized)
to candidate WP_041364244.1 METME_RS12940 branched-chain amino acid transaminase
Query= CharProtDB::CH_024500 (309 letters) >NCBI__GCF_000214665.1:WP_041364244.1 Length = 308 Score = 273 bits (699), Expect = 3e-78 Identities = 136/301 (45%), Positives = 194/301 (64%), Gaps = 2/301 (0%) Query: 8 YIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQRLHDSAKI 67 +IW +G+ V W +AKVHV++H LHYG VFEG+R Y + G +F+ EH RL+ SA I Sbjct: 10 WIWLDGQWVEWREAKVHVLTHTLHYGCGVFEGLRAYKTDNGTAIFKLPEHTDRLYRSAHI 69 Query: 68 YRFPVSQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDVIIAAFPW 127 + S +EL +A +D + KNNL SAYIR ++F G GMG+ V++AA+ W Sbjct: 70 MNMKMPFSKEELNQAHKDAVAKNNLDSAYIRSMVFFGSEGMGLRAD-NLKVHVMVAAWTW 128 Query: 128 GAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALD 187 GAYLGAE +E+GI SS+ R N+ AKA GNY++S+L EA GY E + LD Sbjct: 129 GAYLGAENMEKGIRIRTSSYTRNHVNSTMCKAKANGNYINSILALQEALSTGYDEALLLD 188 Query: 188 VNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVREQVLSRESL 247 G+ +EG+GENLF V++G ++TP T+SAL GITRD +I +A+E G EV E+ ++R+ + Sbjct: 189 HEGFCAEGSGENLFIVRNGKIYTPE-TTSALEGITRDTLITIAREQGYEVIEKRITRDEV 247 Query: 248 YLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTGETEDKWGWLDQV 307 Y+ADE F +G+AAE+TP+R D +G G GP+T+++Q +F G D WL V Sbjct: 248 YVADEAFFTGSAAEVTPIRQYDNRDIGSGSRGPITEKLQTLYFDYVHGRRADHKDWLSLV 307 Query: 308 N 308 + Sbjct: 308 S 308 Lambda K H 0.319 0.136 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 305 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 308 Length adjustment: 27 Effective length of query: 282 Effective length of database: 281 Effective search space: 79242 Effective search space used: 79242 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory