Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate WP_041376800.1 PNAP_RS18245 anthranilate phosphoribosyltransferase
Query= SwissProt::Q8PD71 (345 letters) >NCBI__GCF_000015505.1:WP_041376800.1 Length = 348 Score = 460 bits (1184), Expect = e-134 Identities = 228/340 (67%), Positives = 275/340 (80%) Query: 3 ITPQQALQRTIEHREIFHDEMVDLMRQIMRGEVSDAMVSAILTGLRVKKETIGEIAGAAT 62 IT +ALQRTIEHREIFHDEM+ +MR IM GE+S M +A++TGLRVKKETIGEI AA Sbjct: 7 ITASEALQRTIEHREIFHDEMLHIMRLIMSGEMSPLMTAALITGLRVKKETIGEITAAAQ 66 Query: 63 VMREFSRRVEVTDRRHMVDIVGTGGDGSHTFNISTCAMFVAAAGGAKVAKHGNRSVSSKS 122 VMREFS +V V D+ H+VDIVGTGGDGSHTFNISTCAMFVAA+ GA+V+KHG RSVSSKS Sbjct: 67 VMREFSTKVHVADKTHLVDIVGTGGDGSHTFNISTCAMFVAASAGARVSKHGGRSVSSKS 126 Query: 123 GSADALEALGAVIELQPEQVAASLAQTGIGFMYAPVHHPAMKVVAPVRREMGVRTIFNIL 182 GSAD +E+LG + L PE +A + + G+GFM+AP HHPAMK VAPVR+E+G+RTIFNIL Sbjct: 127 GSADVVESLGISLNLSPEAIARCIEEVGVGFMFAPNHHPAMKNVAPVRKELGIRTIFNIL 186 Query: 183 GPLTNPAGSPNILMGVFHPDLVGIQARVLQELGAERALVVWGRDGMDELSLGAGTLVGEL 242 GPLTNPA +PNILMGVFHPDLVGIQ R LQ LGAE ALVV+G+DGMDE+SLGA T+VGEL Sbjct: 187 GPLTNPASAPNILMGVFHPDLVGIQVRALQRLGAEHALVVYGKDGMDEVSLGAATVVGEL 246 Query: 243 RDGQVHEYEVHPEDFGIAMSASRNLKVADAAESRAMLLQVLDNVPGPALDIVALNAGAAL 302 +DG++ EYE+HPEDFGI M+++R L+V +S+AMLL VLDN PG DIV LNAGAAL Sbjct: 247 KDGEITEYEIHPEDFGIPMASNRALRVETPEQSKAMLLGVLDNQPGAPRDIVILNAGAAL 306 Query: 303 YVAGVADSIADGIVRARQVLADGSARACLDAYVAFTQQAT 342 Y A V +S+ DG+ RA+ + G+AR L F+Q A+ Sbjct: 307 YAANVVNSMKDGMDRAQAAIESGAARRKLAQLAEFSQSAS 346 Lambda K H 0.320 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 438 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 345 Length of database: 348 Length adjustment: 29 Effective length of query: 316 Effective length of database: 319 Effective search space: 100804 Effective search space used: 100804 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_041376800.1 PNAP_RS18245 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.23372.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-129 416.6 1.5 4.4e-129 416.5 1.5 1.0 1 lcl|NCBI__GCF_000015505.1:WP_041376800.1 PNAP_RS18245 anthranilate phosph Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015505.1:WP_041376800.1 PNAP_RS18245 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 416.5 1.5 4.4e-129 4.4e-129 1 329 [. 13 340 .. 13 341 .. 0.99 Alignments for each domain: == domain 1 score: 416.5 bits; conditional E-value: 4.4e-129 TIGR01245 1 leklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekeese 69 l++ ++++++ ++e+ ++m+ imsge+s+ aA+++ lrvk et+ ei+++a+++re ++kv++ +++ lcl|NCBI__GCF_000015505.1:WP_041376800.1 13 LQRTIEHREIFHDEMLHIMRLIMSGEMSPLMTAALITGLRVKKETIGEITAAAQVMREFSTKVHVADKT 81 578999*************************************************************** PP TIGR01245 70 elvDivGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsl 138 +lvDivGTGGDg++t+NiST +++vaa+aG++v KhG rsvssksGsaDv+e lg++l+lspe++ar++ lcl|NCBI__GCF_000015505.1:WP_041376800.1 82 HLVDIVGTGGDGSHTFNISTCAMFVAASAGARVSKHGGRSVSSKSGSADVVESLGISLNLSPEAIARCI 150 ********************************************************************* PP TIGR01245 139 eevgigFlfAPkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlg 207 eevg+gF+fAP++hpa+k+vapvRkeLg+rt+fN+LGPL+nPa+a++ ++Gv+++dlv + +++l++lg lcl|NCBI__GCF_000015505.1:WP_041376800.1 151 EEVGVGFMFAPNHHPAMKNVAPVRKELGIRTIFNILGPLTNPASAPNILMGVFHPDLVGIQVRALQRLG 219 ********************************************************************* PP TIGR01245 208 vkralvvhgedglDEisltgetkvaelkdgeieeytlspedfglkraeleelkggsaeenaellkevle 276 +++alvv g+dg+DE+sl + t v elkdgei+ey+++pedfg+++a+ ++l+++++e++ ++l vl lcl|NCBI__GCF_000015505.1:WP_041376800.1 220 AEHALVVYGKDGMDEVSLGAATVVGELKDGEITEYEIHPEDFGIPMASNRALRVETPEQSKAMLLGVLD 288 ********************************************************************* PP TIGR01245 277 gkekkakrdivvlNaaaalyvagkakdlkegvelakeaiksgkalekleelva 329 ++ +a rdiv+lNa+aaly+a++++++k+g+++a++ai+sg+a kl++l++ lcl|NCBI__GCF_000015505.1:WP_041376800.1 289 NQP-GAPRDIVILNAGAALYAANVVNSMKDGMDRAQAAIESGAARRKLAQLAE 340 999.888*****************************************99986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (348 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 10.63 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory