Align Putative (R)-citramalate synthase CimA; EC 2.3.3.21 (uncharacterized)
to candidate WP_041456624.1 AVA_RS04740 homocitrate synthase
Query= curated2:Q8TYM1 (509 letters) >NCBI__GCF_000204075.1:WP_041456624.1 Length = 376 Score = 288 bits (737), Expect = 2e-82 Identities = 159/358 (44%), Positives = 220/358 (61%), Gaps = 4/358 (1%) Query: 12 DEVRIFDTTLRDGEQTPGVALTPEEKLRIARKLDEIGVDTIEAGFAAASEGELKAIRRIA 71 ++V I DTTLRDGEQ GVA + EEK+ IA+ LD IGVD IE G A + E +AI I Sbjct: 2 NKVLINDTTLRDGEQAAGVAFSVEEKIAIAKFLDAIGVDEIEVGIPAMGKAEQEAIANIV 61 Query: 72 REELDAEVCSMARMVKGDVDAAVEAEADAVHIVVPTSEVHVKKKLRMDREEVLERAREVV 131 + L A + R V D+ A++ VHI +P S + + K + VL++ + + Sbjct: 62 KLNLSANLLGWNRAVISDIQASIACGLQRVHISIPVSAIQIAAKFHGQWQVVLQKLHDSI 121 Query: 132 EYARDHGLTVEISTEDGTRTELEYLYEVFDACLEAGAERLGYNDTVGVMAPEGMFLAVKK 191 +A D GL V I ED +R E +L +V A E GA R + DTVG++ P F K Sbjct: 122 SFAVDQGLFVSIGGEDSSRAEESFLLDVVLAAQEWGASRFRFCDTVGILDP---FTTHAK 178 Query: 192 LRERVGEDVI-LSVHCHDDFGMATANTVAAVRAGARQVHVTVNGIGERAGNAALEEVVVV 250 +++ V I + +H H+DFG+ATAN +A ++AGA V+ TVNG+GERAGNAALEEVV+ Sbjct: 179 IKQLVASLTIPVEMHTHNDFGLATANALAGIKAGALSVNTTVNGLGERAGNAALEEVVMA 238 Query: 251 LEELYGVDTGIRTERLTELSKLVERLTGVRVPPNKAVVGENAFTHESGIHADGILKDEST 310 L+ LY D GI T RL E+S+LV +G VPP KA+VGEN F HESGIHA G+L++ T Sbjct: 239 LKHLYHHDLGIDTRRLLEISQLVVSASGHPVPPWKAIVGENTFAHESGIHAHGVLQNPQT 298 Query: 311 YEPIPPEKVGHERRFVLGKHVGTSVIRKKLKQMGVDVDDEQLLEILRRLKRLGDRGKR 368 YEP PE+VG ERR V+GKH G ++ L+Q + ++ E+ +L +++ KR Sbjct: 299 YEPFAPEEVGRERRLVVGKHSGRHLLSSILQQHDIILNHEETQSVLDAVRQESVEKKR 356 Lambda K H 0.315 0.134 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 410 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 509 Length of database: 376 Length adjustment: 32 Effective length of query: 477 Effective length of database: 344 Effective search space: 164088 Effective search space used: 164088 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory