Align periplasmic dehydroquinate dehydratase (EC 4.2.1.10) (characterized)
to candidate WP_041575779.1 XAUT_RS17650 type II 3-dehydroquinate dehydratase
Query= metacyc::MONOMER-15328 (160 letters) >NCBI__GCF_000017645.1:WP_041575779.1 Length = 146 Score = 155 bits (392), Expect = 3e-43 Identities = 78/139 (56%), Positives = 97/139 (69%), Gaps = 1/139 (0%) Query: 17 ITVLNGPNLNMLGLRQPGIYGHATLDDVEQVCIQAAERLDVAIDFRQTNGEGELVSWVQE 76 + VLNGPNLN+LG R+PGIYG ATL DVE +C L I FRQTN EG LV ++QE Sbjct: 5 VHVLNGPNLNLLGTREPGIYGAATLADVEALCRAEGAALGFEIHFRQTNSEGALVDFIQE 64 Query: 77 CRGRADGIVINPAAYGHTSIALLDALLAVELPVIEVHISNIHRREPFRHHTYVSQAAIGV 136 RG A GIV+N AAY HTS+AL DA+ AV +P IEVH+SN+ RE FRHH+++S GV Sbjct: 65 ARG-ARGIVLNAAAYTHTSVALRDAVAAVGVPTIEVHLSNVFAREAFRHHSFLSPVVRGV 123 Query: 137 ICGLGVRGYAHALQAITDM 155 ICG G + Y L+A+ + Sbjct: 124 ICGFGPQSYVLGLRALASL 142 Lambda K H 0.322 0.139 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 108 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 160 Length of database: 146 Length adjustment: 17 Effective length of query: 143 Effective length of database: 129 Effective search space: 18447 Effective search space used: 18447 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 43 (21.2 bits)
Align candidate WP_041575779.1 XAUT_RS17650 (type II 3-dehydroquinate dehydratase)
to HMM TIGR01088 (aroQ: 3-dehydroquinate dehydratase, type II (EC 4.2.1.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01088.hmm # target sequence database: /tmp/gapView.2285.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01088 [M=141] Accession: TIGR01088 Description: aroQ: 3-dehydroquinate dehydratase, type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-60 188.5 0.0 2.7e-60 188.2 0.0 1.0 1 lcl|NCBI__GCF_000017645.1:WP_041575779.1 XAUT_RS17650 type II 3-dehydroqu Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000017645.1:WP_041575779.1 XAUT_RS17650 type II 3-dehydroquinate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 188.2 0.0 2.7e-60 2.7e-60 2 138 .. 5 140 .. 4 142 .. 0.98 Alignments for each domain: == domain 1 score: 188.2 bits; conditional E-value: 2.7e-60 TIGR01088 2 ilvlnGPnlnlLGkrepkvyGsltleeieelleeaakelevevevfqsnsegelidkihealeqvdgiv 70 + vlnGPnlnlLG+rep++yG+ tl ++e+l+++++++l+ e++++q+nseg l+d i+ea + + giv lcl|NCBI__GCF_000017645.1:WP_041575779.1 5 VHVLNGPNLNLLGTREPGIYGAATLADVEALCRAEGAALGFEIHFRQTNSEGALVDFIQEARG-ARGIV 72 78***********************************************************96.69*** PP TIGR01088 71 inpaalthtsvalrDalaavslPvvevhlsnvhareefrkksvlaevakGvivGlGakgyklalealv 138 +n+aa+thtsvalrDa+aav +P++evhlsnv are fr++s+l++v +Gvi+G+G+++y l+l+al+ lcl|NCBI__GCF_000017645.1:WP_041575779.1 73 LNAAAYTHTSVALRDAVAAVGVPTIEVHLSNVFAREAFRHHSFLSPVVRGVICGFGPQSYVLGLRALA 140 *****************************************************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (141 nodes) Target sequences: 1 (146 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 5.42 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory