Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate WP_043765396.1 U743_RS02940 dihydrodipicolinate synthase family protein
Query= metacyc::BSU16770-MONOMER (290 letters) >NCBI__GCF_000733765.1:WP_043765396.1 Length = 330 Score = 73.9 bits (180), Expect = 4e-18 Identities = 46/148 (31%), Positives = 73/148 (49%), Gaps = 2/148 (1%) Query: 17 KGNVDFQKLSTLIDYLLKNGTDSLVVAGTTGESPTLSTEEKIALFEYTVKEVNGRVPVIA 76 + VD + + + L+ G D++V G+ GE TL+ EEK A V+ V GRVP+ Sbjct: 32 QNTVDLDETARAAEKLIAAGVDAIVTLGSLGECATLTWEEKRAYLSTLVETVRGRVPLFG 91 Query: 77 GTGSNNTKDSIKLTKKAEEAGVDAVMLVTPYYNKPSQEGMYQHFKAIA-AETSLPVMLYN 135 GT S T+++I+ T++A + G+D VML P + P Q ++ +A A + +Y Sbjct: 92 GTSSLGTRETIRQTREARDIGIDGVMLGPPMWCAPDVPTAVQFYRDVAEACPDTAICIYA 151 Query: 136 VPGRTVASLAPETTIRLAADIPNVVAIK 163 P P A+IP V+ K Sbjct: 152 NPEAFKFDF-PRPFWAQVAEIPQVITAK 178 Lambda K H 0.313 0.131 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 330 Length adjustment: 27 Effective length of query: 263 Effective length of database: 303 Effective search space: 79689 Effective search space used: 79689 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory