Align 3-isopropylmalate dehydratase small subunit; EC 4.2.1.33; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase (uncharacterized)
to candidate WP_043765845.1 U743_RS04575 aconitate hydratase
Query= curated2:B4U7M0 (165 letters) >NCBI__GCF_000733765.1:WP_043765845.1 Length = 646 Score = 73.9 bits (180), Expect = 5e-18 Identities = 59/167 (35%), Positives = 87/167 (52%), Gaps = 19/167 (11%) Query: 12 DNIDTDQIIPARY----LNTSDPLELASHVMEDSEKPNFAKEHQEGD-IIVAGKNFGSGS 66 DN+ TD+I+ A ++ P E+A+ V + + A+ GD IV G N+G GS Sbjct: 482 DNVSTDEIMRAGAEVLPFRSNIP-EIANFVYDQVDAEYLARAQATGDHAIVGGDNYGQGS 540 Query: 67 SREHAPIAIKYAGVPVVVAKSFARIFFRNAINIG-LPIVECKEAVDEAEDGDIFEIDLEN 125 SREHA +A +Y G+ V+AKSFARI ++N +N G LP+ A EA D I LE Sbjct: 541 SREHAALAPRYLGLRAVLAKSFARIHWQNLVNFGVLPLTFADPADAEALPRDSV-IGLE- 598 Query: 126 GIVKNVTKNKTYSST----------KFPEELMAILRAGGLMEYAKSR 162 G+ + + S+ E +A+LRAGGL+ + + R Sbjct: 599 GLHQALAAGPEISAQCDGRTLRLKHALSERQVALLRAGGLINWMRER 645 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 165 Length of database: 646 Length adjustment: 28 Effective length of query: 137 Effective length of database: 618 Effective search space: 84666 Effective search space used: 84666 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory