Align aromatic-amino-acid transaminase (EC 2.6.1.57) (characterized)
to candidate WP_043828171.1 RSPH17029_RS12840 aspartate/tyrosine/aromatic aminotransferase
Query= BRENDA::P04693 (397 letters) >NCBI__GCF_000015985.1:WP_043828171.1 Length = 394 Score = 282 bits (721), Expect = 1e-80 Identities = 154/389 (39%), Positives = 226/389 (58%), Gaps = 9/389 (2%) Query: 11 DPILTLMERFKEDPRSDKVNLSIGLYYNEDGIIPQLQAVAEAEARLNAQPHGASLYLPME 70 D IL L++ F+ED R+DK++L +G+Y + G+ P ++AV AE RL + Y + Sbjct: 11 DKILQLIQMFREDARADKIDLGVGVYKDPTGLTPVMRAVKAAEKRL-WEVETTKTYTGLA 69 Query: 71 GLNCYRHAIAPLLFGADHPVLKQQRVATIQTLGGSGALKVGADFLKRYFPESGVWVSDPT 130 G Y A+A L+ P RVA++ T GG+GA++ + ++ PE+ VW+S+PT Sbjct: 70 GEPAYNAAMAKLILAGAVPA---DRVASVATPGGTGAVRQALELIRMASPEATVWISNPT 126 Query: 131 WENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATLKTLPARSIVLLHPCCHNPTGADL 190 W NH++I G + Y ++D T V ++ L + A +VLLH CCHNPTGA+ Sbjct: 127 WPNHLSIVKYLGIPMREYRYFDAETGAVDAEGMMEDLAQVKAGDVVLLHGCCHNPTGANP 186 Query: 191 TNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRAIASAGLPALVSNSFSKIFS 250 QW AV E L +P +D+AYQGFG G+E DA A R +A+ L++ S SK F Sbjct: 187 NPVQWLAVCESLARTGAVPLIDLAYQGFGDGLEMDAAATRLLATRLPEVLIAASCSKNFG 246 Query: 251 LYGERVGGLSVMCEDAEAAGR--VLGQLKATVRRNYSSPPNFGAQVVAAVLNDEALKASW 308 +Y ER G ++ EAAGR V L R+NYS PP+ GA++V +L DE L A W Sbjct: 247 IYRERTG---ILIAIGEAAGRGTVQANLNFLNRQNYSFPPDHGARLVTMILEDETLSADW 303 Query: 309 LAEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQRGMFSYTGLSAAQVDRLREEFGV 368 AE+EE+R +L +R++L L E F ++ RGMFS G++ A+V+RLR E GV Sbjct: 304 KAELEEVRLNMLTLRRQLADALQAETGSNRFGFVAEHRGMFSRLGITPAEVERLRTEHGV 363 Query: 369 YLIASGRMCVAGLNTANVQRVAKAFAAVM 397 Y++ R+ +AGLN V +A+A A V+ Sbjct: 364 YMVGDSRLNIAGLNRTTVPVLARAVAKVL 392 Lambda K H 0.320 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 387 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 394 Length adjustment: 31 Effective length of query: 366 Effective length of database: 363 Effective search space: 132858 Effective search space used: 132858 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 16 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory