Align kynurenine-oxoglutarate transaminase (EC 2.6.1.7) (characterized)
to candidate WP_043879080.1 AZC_RS08165 pyridoxal phosphate-dependent aminotransferase
Query= BRENDA::Q16773 (422 letters) >NCBI__GCF_000010525.1:WP_043879080.1 Length = 401 Score = 244 bits (622), Expect = 4e-69 Identities = 148/395 (37%), Positives = 208/395 (52%), Gaps = 39/395 (9%) Query: 24 LASEHDVVNLGQGFPDFPPP-DFAVEAFQHAVSGDFMLNQYTKTFGYPPLTKILASFFGE 82 LA H VNLGQGFPD P P D +A V G NQY G L + A + Sbjct: 35 LARTHQAVNLGQGFPDDPGPLDVRQKAADAVVDG---WNQYPPMMGLADLRQAAAVHYKH 91 Query: 83 LLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFV 142 G ++DP V+VT G AL A +L++ GDEV++ +P +D Y P+ AGG P V Sbjct: 92 WQGLDLDPESEVMVTSGATEALAGALFSLIEPGDEVVLFQPLYDAYLPLVQRAGGIPRLV 151 Query: 143 SLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASL 202 L+P +W++ +L F+ RTK ++ N P NP G V SREE++L+A Sbjct: 152 RLEP-----------PSWRITAEKLEAAFSPRTKVVLFNNPQNPTGIVHSREEMQLIADF 200 Query: 203 CQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGP 262 C + DV+ + DEV++ +++DG +H+ + ++PGM ERT+ I SAGK F TGWKVG V Sbjct: 201 CIRFDVIAVCDEVWEHVIFDGRRHLPMMAIPGMRERTVKISSAGKIFGMTGWKVGLVFAQ 260 Query: 263 DHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIR 322 +M+ L HQ F P QAAVA +E +YF +QR RD + + Sbjct: 261 PELMRVLGKAHQFLTFTTPPNLQAAVAYGLGKE-------DAYFEDMRADLQRSRDRLAK 313 Query: 323 SLQSVGLKPIIPQ-GSYFLITDISDFKRKMPDLPGAVDEPY-DRRFVKWMIKNKGLVAIP 380 L +G P++P G+YFL D++ A+D D F ++K G+ AIP Sbjct: 314 GLSDLGF-PVLPSAGTYFLSVDLA-----------AIDPTLDDEAFCLDLVKTHGVAAIP 361 Query: 381 VSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKL 415 VS FY+ Q +RFCF K +ATL A E+L Sbjct: 362 VSAFYA---QDAVRSVVRFCFAKRDATLDAALERL 393 Lambda K H 0.323 0.139 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 411 Number of extensions: 26 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 422 Length of database: 401 Length adjustment: 31 Effective length of query: 391 Effective length of database: 370 Effective search space: 144670 Effective search space used: 144670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory