Align cysteine-S-conjugate beta-lyase (EC 4.4.1.13) (characterized)
to candidate WP_043879082.1 AZC_RS08210 cystathionine beta-lyase
Query= BRENDA::P43623 (340 letters) >NCBI__GCF_000010525.1:WP_043879082.1 Length = 393 Score = 325 bits (832), Expect = 2e-93 Identities = 162/328 (49%), Positives = 219/328 (66%), Gaps = 2/328 (0%) Query: 14 TQLSVIGRNPDEQSGFVNPPLYKGSTIILKKLSDLEQRKGRF-YGTAGSPTIDNLENAWT 72 T++ +G +P GFVNPP+ +GST++ DL GR+ YG G+PT + L+NA T Sbjct: 14 TRVVHLGLDPFRFDGFVNPPVVRGSTVLSPTYKDLVGHTGRYSYGRRGNPTSEALQNAVT 73 Query: 73 HLTGGAGTVLSASGLGSISLALLALSKAGDHILMTDSVYVPTRMLCDGLLAKFGVETDYY 132 L GG GTVL+ SGL +IS+ALL++ AGDH+LM D+ Y PTR C +L + GVET +Y Sbjct: 74 ALEGGDGTVLTPSGLSAISVALLSVVGAGDHLLMVDTAYNPTRQFCTRVLKRMGVETTHY 133 Query: 133 DPSIGKDIEKLVKPNTTVIFLESPGSGTMEVQDIPALVSVAKKHGIKTILDNTWATPLFF 192 DP +G I L++PNT IFLESPGS + E+QDIPA+V+VAK GI T++DNTWATPLFF Sbjct: 134 DPLVGAGIADLIRPNTRAIFLESPGSQSFEMQDIPAIVAVAKARGITTLIDNTWATPLFF 193 Query: 193 DAHAHGIDISVEAGTKYLGGHSDLLIGLASANEECWPLLRSTYDAMAMLPGAEDCQLALR 252 HA GID+S++AGTKYLGGH+DL +G SA + W L +T+ M + +D L LR Sbjct: 194 KPHAFGIDLSIQAGTKYLGGHADLNLGTVSAKGDAWKGLIATHGDMGICISPDDAALGLR 253 Query: 253 GMRTLHLRLKEVERKALDLAAWLGNRDEVEKVLHPAFEDCPGHEYWVRDYKGSSGLFSIV 312 G+RTL +RL + L++A WL V +VLHPA E PGH W RD+ G+ GLFS++ Sbjct: 254 GLRTLAVRLARHQASGLEVARWLEASPYVSRVLHPALESHPGHAVWKRDFTGACGLFSLI 313 Query: 313 LKNGFTRAGLEKMVEGMKVLQLGFSWGG 340 LK A + + +K+ +G+SWGG Sbjct: 314 LK-PVPEAAVATFFDSLKLFGMGYSWGG 340 Lambda K H 0.318 0.137 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 393 Length adjustment: 30 Effective length of query: 310 Effective length of database: 363 Effective search space: 112530 Effective search space used: 112530 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory