Align Histidinol-phosphate aminotransferase; EC 2.6.1.9; Imidazole acetol-phosphate transaminase (uncharacterized)
to candidate WP_044137258.1 TERY_RS07480 threonine-phosphate decarboxylase
Query= curated2:B0K625 (351 letters) >NCBI__GCF_000014265.1:WP_044137258.1 Length = 356 Score = 138 bits (348), Expect = 2e-37 Identities = 102/333 (30%), Positives = 185/333 (55%), Gaps = 17/333 (5%) Query: 29 ANETPFELPEEVIKNIQEIVKSSQVNVYPDPTAEKLKEELA-RYCGVVPTNIFVGNGSDE 87 A+ P LP+ I+ IQ + S++ YPDP ++LK+ L+ + + I GNG+ E Sbjct: 29 ASINPLGLPDSAIQAIQTNI--SKLGAYPDPNYQELKKALSLAHPPLTSEWILPGNGAAE 86 Query: 88 IIHLIMLAFINKGDVVAYPHPSFAMY--SVYSKIAGAVEIPVRLREDYNYDVDSFIKVIE 145 ++ L ++K + V P+F Y ++ + A +E P+++ E ++ IE Sbjct: 87 LLTWAALD-LSKLEAVYLLTPAFGDYRRALKTFTANVIECPLKVGESKLTELQEL--QIE 143 Query: 146 KYQPKLVFLCNPNNPTGSVIEREDIIKIIQKSNGIVVVDEAYFEFY----GNTIVDAINE 201 K + L NP+NPTG ++E E I+ ++K G+VVVDEA+ +F ++V + + Sbjct: 144 IDTDKGLLLNNPHNPTGLLMEVETIVPFLEKF-GLVVVDEAFMDFLPPPQAQSLVPLVTK 202 Query: 202 FENLIVLRTLSKAFGLAGLRVGYAVANENILKYLNLVKSPYNINSLSQIIALKVLRTDVL 261 F NL++LR+L+K + L GLR+GYA+++ L+ + P+ +N+L+ A VL V Sbjct: 203 FHNLVILRSLTKFYSLPGLRLGYAISHPERLRKWQKWRDPWPVNTLAIAAAQAVLEDQVF 262 Query: 262 KERI-NYILEERKRLIKELGKIPGVKVYPSKTNFILV-KFKDADYVYQGLLER-GILVRD 318 +++ +++ + R +L + L ++PG++ P NF+LV K D++ LL++ IL+RD Sbjct: 263 QQQTWDWLADARPQLFQGLAELPGLQPCPGAANFLLVHSEKSVDWLQTTLLKKHRILIRD 322 Query: 319 FSKVEGL-EGALRITVSSCEANDYLINGLKELL 350 S L + R+ V + E N L++ L ++L Sbjct: 323 GSSFPELGDRYFRVAVRTQEDNQKLVDALGQIL 355 Lambda K H 0.319 0.140 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 351 Length of database: 356 Length adjustment: 29 Effective length of query: 322 Effective length of database: 327 Effective search space: 105294 Effective search space used: 105294 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory