Align Beta-phenylalanine transaminase; Aromatic beta-amino acid aminotransferase; Beta-phenylalanine aminotransferase; VpAT; EC 2.6.1.- (characterized)
to candidate WP_044410780.1 NA59_RS08095 glutamate-1-semialdehyde-2,1-aminomutase
Query= SwissProt::H8WR05 (434 letters) >NCBI__GCF_000934765.1:WP_044410780.1 Length = 426 Score = 216 bits (549), Expect = 1e-60 Identities = 137/412 (33%), Positives = 205/412 (49%), Gaps = 22/412 (5%) Query: 28 FEAQARYMPGANSRSVLFYAPF---PLTIARGEGAALWDADGHRYADFIAEYTAGVYGHS 84 F A +++PG + V + P+ GA L D D +Y D++ + + GH+ Sbjct: 8 FIAAQKHIPGGVNSPVRAFKGVGGDPIFFKSAHGAYLTDEDDKKYIDYVGSWGPAILGHA 67 Query: 85 APEIRDAVIEAMQGGINLTGHNLLEGRLARLICERFPQIEQLRFTNSGTEANLMALTAAL 144 PE+ AV + G++ ++E +A L+CE P + +R +SGTEA + A+ A Sbjct: 68 HPEVIQAVQRQAEHGLSFGAPTVMETTMADLVCELIPSFDMVRMVSSGTEATMTAIRLAR 127 Query: 145 HFTGRRKIVVFSGGYHG-----------GVLGFGARPS---PTTVPFDFLVLPYNDAQTA 190 +TGR KIV F G YHG G L G S P + + L L +NDA Sbjct: 128 GYTGRDKIVKFEGCYHGHSDSLLVKAGSGALTLGVPSSPGVPAALASETLTLTHNDADEV 187 Query: 191 RAQIERHGPEIAVVLVEPMQGASGCIPGQPDFLQALRESATQVGALLVFDEVMTS-RLAP 249 R G +IA ++VEP+ G CIP +P FL+ALRE Q GA+L+FDEVM R+ Sbjct: 188 RQVFSEIGDQIACIIVEPVAGNMNCIPPEPGFLEALREVCDQHGAVLIFDEVMCGFRVGL 247 Query: 250 HGLANKLGIRSDLTTLGKYIGGGMSFGAFGGRADVMALFDPRTGPLAHSGTFNNNVMTMA 309 G + G+ D+TT GK IGGGM GAFGG+ ++M+ P GP+ +GT + N + MA Sbjct: 248 QGAQGRYGVTPDITTFGKVIGGGMPVGAFGGKKEIMSHIAP-LGPVYQAGTLSGNPIAMA 306 Query: 310 AGYAGLTKLFTPEAAGALAERGEALRARLNALCANEGVAMQFTGIGSLMNAHFVQGDVRS 369 AG L L +P L ++ + L L A+ G+ +G + F + + Sbjct: 307 AGLMTLNLLKSPAFFEHLEQKTKRLVDGLQAVADEAGIPFTTNQVGGMFGFFFTEEKNIT 366 Query: 370 SEDLAAVDGRLRQLLFFH-LLNEDIYSSPRGFVV--LSLPLTDADIDRYVAA 418 A R F+H +LNE +Y +P F +S ++ADID+ + A Sbjct: 367 RFAQVARGDMARFRKFYHGMLNEGVYLAPSAFEAGFISAAHSNADIDQTIEA 418 Lambda K H 0.322 0.138 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 479 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 434 Length of database: 426 Length adjustment: 32 Effective length of query: 402 Effective length of database: 394 Effective search space: 158388 Effective search space used: 158388 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory