Align Alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial; Beta-alanine-pyruvate aminotransferase 1; EC 2.6.1.44 (characterized)
to candidate WP_044410795.1 NA59_RS08125 aspartate aminotransferase family protein
Query= SwissProt::Q940M2 (476 letters) >NCBI__GCF_000934765.1:WP_044410795.1 Length = 392 Score = 186 bits (471), Expect = 2e-51 Identities = 125/404 (30%), Positives = 197/404 (48%), Gaps = 39/404 (9%) Query: 74 YYQKPLNIVEGKMQYLYDESGRRYLDAFAGIVTVSCGHCHPDILNAITEQSKLLQHATTI 133 Y + P+ VEG+ LYDE GR YLDA +GI S GH HP+I +A+ EQSK L H + + Sbjct: 9 YARLPITFVEGEGATLYDEQGRAYLDAVSGIAVCSLGHAHPEIAHALCEQSKKLIHTSNL 68 Query: 134 YLHHAIGDFAEALAAKMPGNLKVVYFVNSGSEANELAMMMARLYTGSL-----EMISLRN 188 Y H + A + V+F NSG+EANE A+ +AR Y E++ + N Sbjct: 69 Y--HVVNQQLLADELIRLSGMDKVFFGNSGAEANEGAIKIARKYGNDQGKTNPEILVMEN 126 Query: 189 AYHGGSSNTIGLTALNTWK---YPLPQGEIHHVVNPDPYRGVFGSDGSLYAKDVHDHIEY 245 ++HG + T+ T + +PL G + V D + + + H Sbjct: 127 SFHGRTMATLSATGSQKVQEGFHPLVSGFVR----------VPFDDIAAVEQKIASH--- 173 Query: 246 GTSGKVAGFIAETIQGVGGAVELAPGYLKSVYEIVRNAGGVCIADEVQTGFGRTGSHYWG 305 + + E +QG GG GYLK++ + + + DE+QTG GRTG ++ Sbjct: 174 ---PNLVAILVEPVQGEGGVHVPKDGYLKALRALCDQHNLLLMIDEIQTGVGRTGK-WFA 229 Query: 306 FQTQDVVPDIVTMAKGIGNGLPLGAVVTTPEIASVLASKILFNTFGGNPVCSAGGLAVLN 365 FQ +D++PD++++AK +GNG+P+GA + + A VLA TFGGNP+ A GLAV+ Sbjct: 230 FQHEDILPDVLSLAKALGNGVPIGACLARGKAAEVLAPGNHGTTFGGNPLACAAGLAVIK 289 Query: 366 VIDKEKRQEHCAEVGSHLIQRLKDVQKRHDIIGDVRGRGLMVGIELVSDRKDKTPAKAET 425 I+ ++ A+ G +I K + + VRG+G M+GI+L + + Sbjct: 290 TIEHHNFIDYVAKQGEIMISDFKARLAGIEQVKQVRGKGYMIGIQLDRPCGELVKRALDK 349 Query: 426 SVLFEQLRELGILVGKGGLHGNVFRIKPPMCFTKDDADFLVDAL 469 ++L R G+ R+ PP + + LV + Sbjct: 350 NLLINVTR------------GDTIRLLPPFVMSHTQQEQLVSGV 381 Lambda K H 0.320 0.138 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 447 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 476 Length of database: 392 Length adjustment: 32 Effective length of query: 444 Effective length of database: 360 Effective search space: 159840 Effective search space used: 159840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory