Align Ornithine aminotransferase; OAT; EC 2.6.1.13; Ornithine--oxo-acid aminotransferase (uncharacterized)
to candidate WP_044410795.1 NA59_RS08125 aspartate aminotransferase family protein
Query= curated2:Q89RB7 (404 letters) >NCBI__GCF_000934765.1:WP_044410795.1 Length = 392 Score = 259 bits (661), Expect = 1e-73 Identities = 153/373 (41%), Positives = 211/373 (56%), Gaps = 15/373 (4%) Query: 18 HNYEPIGVVLSRGEGVWVWDTDGNRYLDCLSAYSAVSQGHCHPKILAAMVEQAHRLTLTS 77 + Y + + GEG ++D G YLD +S + S GH HP+I A+ EQ+ +L TS Sbjct: 7 NTYARLPITFVEGEGATLYDEQGRAYLDAVSGIAVCSLGHAHPEIAHALCEQSKKLIHTS 66 Query: 78 RAFH--NDQLAPFYEEIAALTGSHKVLPMNSGAEAVESAIKSVRKWGYEVKGVPDDQAEI 135 +H N QL +E+ L+G KV NSGAEA E AIK RK+G + EI Sbjct: 67 NLYHVVNQQLLA--DELIRLSGMDKVFFGNSGAEANEGAIKIARKYGNDQGKT---NPEI 121 Query: 136 IVCADNFHGRTLGIVGFSTDPETRGHFGPFAPGFRIIPFGDAAALEQAIT--PNTVAFLV 193 +V ++FHGRT+ + + + + F P GF +PF D AA+EQ I PN VA LV Sbjct: 122 LVMENSFHGRTMATLSATGSQKVQEGFHPLVSGFVRVPFDDIAAVEQKIASHPNLVAILV 181 Query: 194 EPIQGEAGVIIPPAGYFTKVRELCTANNVMLVLDEIQTGLGRTGKLLAEQHEGIEADVTL 253 EP+QGE GV +P GY +R LC +N++L++DEIQTG+GRTGK A QHE I DV Sbjct: 182 EPVQGEGGVHVPKDGYLKALRALCDQHNLLLMIDEIQTGVGRTGKWFAFQHEDILPDVLS 241 Query: 254 LGKALAGGFYPVSAVLSNNEVLGTLRPGQHGSTFGGNPLACAVARAAMRVLVEEGMIENA 313 L KAL G P+ A L+ + L PG HG+TFGGNPLACA A ++ + I+ Sbjct: 242 LAKALGNG-VPIGACLARGKAAEVLAPGNHGTTFGGNPLACAAGLAVIKTIEHHNFIDYV 300 Query: 314 ARQGARLLEGLKDIRA--NTVREVRGRGLMLAVELHPEAGRARRYCEALQGKGILAKDTH 371 A+QG ++ K A V++VRG+G M+ ++L G + AL K +L T Sbjct: 301 AKQGEIMISDFKARLAGIEQVKQVRGKGYMIGIQLDRPCGELVK--RALD-KNLLINVTR 357 Query: 372 GHTIRIAPPLVIT 384 G TIR+ PP V++ Sbjct: 358 GDTIRLLPPFVMS 370 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 451 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 404 Length of database: 392 Length adjustment: 31 Effective length of query: 373 Effective length of database: 361 Effective search space: 134653 Effective search space used: 134653 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory