Align Putative [LysW]-L-2-aminoadipate/[LysW]-L-glutamate phosphate reductase; EC 1.2.1.103; EC 1.2.1.106 (uncharacterized)
to candidate WP_044411826.1 NA59_RS10005 N-acetyl-gamma-glutamyl-phosphate reductase
Query= curated2:A0RWW0 (348 letters) >NCBI__GCF_000934765.1:WP_044411826.1 Length = 348 Score = 261 bits (666), Expect = 2e-74 Identities = 143/350 (40%), Positives = 205/350 (58%), Gaps = 8/350 (2%) Query: 1 MKVGVVGASGYVGGETLRLLVNHPDVEIAAVTSRQHVGEYLHRVQPSLRGFTDLTFSELD 60 +KVG+VG +GY G E LRLL NHP E+ +TSR G + ++ P+LRG DL FSE D Sbjct: 4 VKVGIVGGTGYTGVELLRLLANHPQAEVVVITSRSEAGMSVAQMFPNLRGHFDLCFSEPD 63 Query: 61 YDRLSDSCDLVFTAVPHGTATDIVRALYDRDIKVIDLSADYRLHDPADYTKWYGWEHPHP 120 +L CDLVF A PHG A + L + ++VIDL+AD+RL D A + +WY H P Sbjct: 64 MAQLK-RCDLVFFATPHGVAMSLTPELIEAGVRVIDLAADFRLTDMAVFEQWYDMPHSCP 122 Query: 121 DYLSKSVFGIPELHREEIRSAKLVSCPGCMAVTSILALAPPVREGLVDTEHIVVDSKIGS 180 + + V+G+PE++R++I++AK+++ PGC LA P ++ G++DT H++ D K G Sbjct: 123 EIMKDVVYGLPEVNRDKIKTAKVIANPGCYPTAIQLAFQPLLKAGIIDTRHLIADGKSGV 182 Query: 181 SGAGAGAGTA--HAMRAGVIRPYKPAKHRHTGEIEQELSGIA-GKKIRVSMSPHAVDVVR 237 SGAG GA A A + R Y HRH EI + LS +A G K+ ++ PH V ++R Sbjct: 183 SGAGRGAKVASLSAETSESFRAYGIDGHRHQPEISEGLSVMAGGGKVNLTFVPHLVPMIR 242 Query: 238 GILCTNHVFLTREASEKDLWKMYRQAYGEERFVRLIRDKKGLYKFPDPKFLVGSNFCDIG 297 GI T + LT + S+ L ++ Y +E+FV D PD + + GSN C + Sbjct: 243 GIEATIYAKLTADWSQSQLQDLFETQYADEKFV----DVMPAGSQPDTRMVKGSNMCRMA 298 Query: 298 FDLDEDNNRLVAISASDNLMKGAAGSAIQNMNIMAGLDEMSGLRYTPLTP 347 + +V S DNL+KGA+G A+QNMN+M GLDE GL+ L P Sbjct: 299 VYRPVGGDVVVVTSVIDNLVKGASGQAVQNMNLMFGLDEDCGLKQVALLP 348 Lambda K H 0.320 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 348 Length of database: 348 Length adjustment: 29 Effective length of query: 319 Effective length of database: 319 Effective search space: 101761 Effective search space used: 101761 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory