Align L-serine/homoserine O-acetyltransferase; Homoserine O-trans-acetylase; EC 2.3.1.30; EC 2.3.1.31 (characterized)
to candidate WP_046007572.1 OLEAN_RS00375 homoserine O-acetyltransferase
Query= SwissProt::D2Z028 (374 letters) >NCBI__GCF_000967895.1:WP_046007572.1 Length = 397 Score = 217 bits (552), Expect = 5e-61 Identities = 131/362 (36%), Positives = 192/362 (53%), Gaps = 16/362 (4%) Query: 6 PPASRFIELPDGFAMRRGGALYGARIAYETFGSLNAARDNAVLVLTGLSPDAHAAS--RP 63 P RF E +R G L + YET+G LNA NA+L+ LS D HAA Sbjct: 15 PKVQRFDE---PLTLRSGRILESYELIYETYGELNADASNAILICHALSGDHHAAGYHSM 71 Query: 64 DDPTPGWWEAMVGPGKPVDTDLWHVICVNSLGSCKGSTGPASTDPRTGEPYRLSFPELSI 123 +D PGWW++ +GPGK +DT+ + V+ +N+LG C GSTGP S +P TG+ Y FP +++ Sbjct: 72 EDKRPGWWDSCIGPGKSIDTNKFFVVSLNNLGGCSGSTGPTSINPETGKAYGPDFPIVAV 131 Query: 124 EDIADAAAHTVRALGISRLACVVGASMGGMSALALLARHPELARTHISLSGAVHALPFSI 183 D + L I + A V+G S+GGM L ++PE R + ++ A +I Sbjct: 132 RDWVRSQKRLADFLKIQQWAAVIGGSLGGMQVLRWSIQYPERLRHALVIASAPKLSAQNI 191 Query: 184 AVRSLQREAIRSDPGWLQGHY-DEGEGPRRGMLTARKLGMMTYRSAQEWDCRFGRTRIGE 242 A + R+AI DP + G Y D G P+ G+ AR LG +TY S +FGR Sbjct: 192 AFNEVARQAISKDPDFHNGRYMDHGVVPKAGLSQARMLGHLTYMSGDAMKEKFGRD---- 247 Query: 243 RRRADQ--GRFGPEFEVESYLDFHAQRFADRFDPNSYLYLSHAMDQFDLGDGGGGGGGAP 300 +AD+ F PEF+VESYL + Q+F+ +FD N+Y+ ++ A+D FD G Sbjct: 248 -LKADELSFSFSPEFQVESYLHYQGQKFSTQFDANTYMLMTKALDYFD--PTVDHDGDLV 304 Query: 301 GALSRMRVERALVMGARTDILFPLSQQQEIADGLSAGGADVSFLPVDTPAGHDAFLVDIE 360 LS+ + + V+ TD F + +EI + L DVS+ + + GHDAFL+ I Sbjct: 305 KCLSQAQC-KFFVVSFTTDWRFAPDRSEEIVNALIQADKDVSYACIASENGHDAFLLPIP 363 Query: 361 RF 362 R+ Sbjct: 364 RY 365 Lambda K H 0.321 0.138 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 427 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 397 Length adjustment: 30 Effective length of query: 344 Effective length of database: 367 Effective search space: 126248 Effective search space used: 126248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory