Align alanine—glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate WP_046008665.1 OLEAN_RS07170 pyridoxal phosphate-dependent aminotransferase
Query= metacyc::MONOMER-21143 (387 letters) >NCBI__GCF_000967895.1:WP_046008665.1 Length = 393 Score = 239 bits (609), Expect = 1e-67 Identities = 138/392 (35%), Positives = 216/392 (55%), Gaps = 8/392 (2%) Query: 1 MKLAKNLQRLGTESAFSVLAEAKKLEAQGKPMIHLGLGQPDFKTPQHVVDAAKKALDEGH 60 ++L+ +Q + +V A +L A GK +I LG G+PDF TP+H+ DAA +AL++G Sbjct: 3 LQLSDRVQNIKPSPTLAVTNRAAELRAAGKDIIGLGAGEPDFDTPKHIKDAAIEALNKGF 62 Query: 61 HGYVLSNGILECRQAVTRKIKKLYNKDIDPERVLIMPGGKPTMYYAIQCFGEPGAEIIHP 120 Y +G ++A+ K K+ P+++L+ GGK + + G E++ P Sbjct: 63 TKYTAVDGTPSLKKAIIDKFKRDNGLSYQPDQILVSCGGKQSFFNMALALLNAGDEVVIP 122 Query: 121 TPAFPIYESMINYTGSTPVPYDLTEDKDLKFDPEKILSLITDKTRLLILINPNNPTGSFV 180 P + Y M+ TPV + + K ++ + IT KT+L++L +P+NP+G Sbjct: 123 APYWVSYPDMVRIAEGTPVIVETEQSNRFKMTAIQLEAAITPKTKLVVLNSPSNPSGVAY 182 Query: 181 EKSAIDVLAEGLKKHPHVAILSDEIYSRQIY-DGKEMPTFFNYPDLQDRLIVLDGWSKAY 239 ++ + LAE L K+P++ I +D++Y ++ +G P+L DR +V++G SKAY Sbjct: 183 TEAELKELAEVLLKYPNILIATDDMYEHILWAEGGFHNIVTVCPELYDRTVVMNGVSKAY 242 Query: 240 AMTGWRMGWSVWPEELIPHVNKLIINSVSCVNAPSQFAGIAALDGPDDAIHEMMVKFDQR 299 +MTGWR+G+ PE L+ + K+ S S + SQ+A AAL+G D I EM+ F R Sbjct: 243 SMTGWRIGYIGGPEVLVKAMKKIQSQSTSNPTSISQYAAEAALNGNQDCIQEMLSAFKVR 302 Query: 300 RKLIHEGLNSLPGVECSLPGGAFYAFPKVIGTGMNGS-----EFAKKCMHEAGVAIVPGT 354 + + LN LPGVEC G FYAFP G S EFA+K + EA VA+VPG+ Sbjct: 303 HDYLVKALNELPGVECIESDGTFYAFPSFKGAIQAASCETDVEFAEKMLIEAEVALVPGS 362 Query: 355 AFGKTCQDYVRFSYAASQDNISNALENIKKML 386 AFG ++R SYA S +N+ A+ + K L Sbjct: 363 AFG--TPGHMRLSYATSMENLETAISRLAKAL 392 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 446 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 393 Length adjustment: 31 Effective length of query: 356 Effective length of database: 362 Effective search space: 128872 Effective search space used: 128872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory