Align amino-acid N-acetyltransferase (EC 2.3.1.1) (characterized)
to candidate WP_046010347.1 OLEAN_RS17770 amino-acid N-acetyltransferase
Query= BRENDA::P22567 (432 letters) >NCBI__GCF_000967895.1:WP_046010347.1 Length = 440 Score = 447 bits (1150), Expect = e-130 Identities = 229/436 (52%), Positives = 302/436 (69%), Gaps = 9/436 (2%) Query: 4 YVNWLRHASPYINSHRDRTFVVMLPGEGVEHPNFGNIVHDLVLLHSLGARLVLVHGSRPQ 63 YV W RH+SPYIN+HR +TFV+ML G+ + NF +IV D+ LL+SLG RLV+VHG+RPQ Sbjct: 6 YVKWFRHSSPYINAHRGKTFVLMLEGDAIADDNFAHIVQDIALLNSLGVRLVIVHGARPQ 65 Query: 64 IEARLAARGLAPRYHRDLRVTDAPTLECVIDAVGSLRIAIEARLSMDMAASPMQGARLRV 123 I+ L + ++H DLR+TD L V A+G ++ IEARLS+ + +PM GAR+RV Sbjct: 66 IDQALNVLNIKSQFHGDLRITDQAALNAVRAAIGIVKSDIEARLSVGLPNTPMHGARIRV 125 Query: 124 AGGNLVTARPIGVVEGVDYHHTGEVRRIDRKGIGRLLDERSIVLLSPLGYSPTGEIFNLA 183 GN VTA+P GV++GVD+ HTGEVRRIDR+ I + LD+ +IVLLS GYSP+GE+FNLA Sbjct: 126 VSGNFVTAKPKGVIDGVDFQHTGEVRRIDRQAISQQLDQGNIVLLSSCGYSPSGEMFNLA 185 Query: 184 CEDVAMRAAIDLEAEKLILYGAEQGLL-------DASGKLVRELRPQQVPAHLQRLGNSY 236 EDVA + AI L AEKLIL G +GL S ++ +L ++ + L + Sbjct: 186 AEDVATQTAISLTAEKLILMGESEGLPATAKESDSDSSMVISQLTTDELSRIIDSLSGEH 245 Query: 237 QAELLDAAAQACRAGVKRSHIVSYTEDGALLSELFTRTGNGTLVAQEQFEQLREAGIEDV 296 + L AA+ A +A + R H++SY DGALL ELFT G GTL+ + +E LR+A EDV Sbjct: 246 KFHAL-AASTAIKAHINRVHLLSYKVDGALLQELFTHEGAGTLITADDYELLRQATTEDV 304 Query: 297 GGLIELIRPLEEQGILVRRSREVLEREIEQFSIVEREGLIIACAALYPIADSEAGELACL 356 G++EL+ PLEEQG+LVRRSRE+LE EI +F ++E +G++IACAALYP + S+ ELAC+ Sbjct: 305 AGILELLTPLEEQGVLVRRSRELLETEIHRFKVIELDGMVIACAALYPYS-SDLAELACV 363 Query: 357 AVNPEYRHGGRGDELLERIEERARGLGLKTLFVLTTRTAHWFRERGFQPSSVERLPAARA 416 AV EYR G RGD LL I +A+ + LFVLTTRTAHWF ERGF + + LP R Sbjct: 364 AVREEYRSGQRGDRLLNAISAQAKAEKINNLFVLTTRTAHWFMERGFSEADISALPQERQ 423 Query: 417 SLYNFQRNSQVFEKSL 432 SLYNFQRNS++F K L Sbjct: 424 SLYNFQRNSKIFIKEL 439 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 510 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 440 Length adjustment: 32 Effective length of query: 400 Effective length of database: 408 Effective search space: 163200 Effective search space used: 163200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_046010347.1 OLEAN_RS17770 (amino-acid N-acetyltransferase)
to HMM TIGR01890 (argA: amino-acid N-acetyltransferase (EC 2.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01890.hmm # target sequence database: /tmp/gapView.32298.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01890 [M=429] Accession: TIGR01890 Description: N-Ac-Glu-synth: amino-acid N-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-179 582.9 1.8 2.4e-179 582.7 1.8 1.0 1 lcl|NCBI__GCF_000967895.1:WP_046010347.1 OLEAN_RS17770 amino-acid N-acety Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000967895.1:WP_046010347.1 OLEAN_RS17770 amino-acid N-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 582.7 1.8 2.4e-179 2.4e-179 1 429 [] 6 439 .. 6 439 .. 0.97 Alignments for each domain: == domain 1 score: 582.7 bits; conditional E-value: 2.4e-179 TIGR01890 1 fvkwlreaaPyinahrdktlvvglggelvedknlgklvadiallhslGvrlvlvhGarpqieerlakrg 69 +vkw+r+++Pyinahr+kt+v++l+g++++d+n++++v+diall+slGvrlv+vhGarpqi++ l+ + lcl|NCBI__GCF_000967895.1:WP_046010347.1 6 YVKWFRHSSPYINAHRGKTFVLMLEGDAIADDNFAHIVQDIALLNSLGVRLVIVHGARPQIDQALNVLN 74 8******************************************************************** PP TIGR01890 70 rtthyvrGlrvtdeaslelvkeaaGelrlaiearlsmslantpmagsrlsvvsGnfvtarPiGvveGvd 138 ++++++ lr+td+a+l+ v+ a G ++++iearls l+ntpm g+r++vvsGnfvta+P Gv++Gvd lcl|NCBI__GCF_000967895.1:WP_046010347.1 75 IKSQFHGDLRITDQAALNAVRAAIGIVKSDIEARLSVGLPNTPMHGARIRVVSGNFVTAKPKGVIDGVD 143 ********************************************************************* PP TIGR01890 139 yehtGevrkidaegirrlldersivllsPlgfsvtGeifnlamedvatsvaiklkadklillteedGi. 206 ++htGevr+id+++i+++ld+++ivlls g+s++Ge+fnla+edvat++ai+l a+klil++e++G+ lcl|NCBI__GCF_000967895.1:WP_046010347.1 144 FQHTGEVRRIDRQAISQQLDQGNIVLLSSCGYSPSGEMFNLAAEDVATQTAISLTAEKLILMGESEGLp 212 *******************************************************************94 PP TIGR01890 207 .....ldadG.klvaelsaqeveslverleeettarllsaavkalrgGvarshlvsyaedGallqelft 269 +d+d ++ +l+++e+ + +++l +e + + l aa a+++ ++r+hl+sy+ dGallqelft lcl|NCBI__GCF_000967895.1:WP_046010347.1 213 atakeSDSDSsMVISQLTTDELSRIIDSLSGEHKFHAL-AASTAIKAHINRVHLLSYKVDGALLQELFT 280 4433334444146789****************966665.6789************************** PP TIGR01890 270 rdGiGtlvskealesireatiddvggilelirPleeqGilvrrsrellereieefsviekdGliigcaa 338 ++G Gtl++ +++e +r+at +dv+gilel+ PleeqG+lvrrsrelle ei++f vie dG++i+caa lcl|NCBI__GCF_000967895.1:WP_046010347.1 281 HEGAGTLITADDYELLRQATTEDVAGILELLTPLEEQGVLVRRSRELLETEIHRFKVIELDGMVIACAA 349 ********************************************************************* PP TIGR01890 339 lypyaeeevgelaclavsPeardggrGerllkhiedrarqvGlkrlfvlttrtehWfrerGfaeasvde 407 lypy+ ++++elac+av e+r g+rG+rll+ i ++a++ +++lfvlttrt+hWf+erGf+ea++ + lcl|NCBI__GCF_000967895.1:WP_046010347.1 350 LYPYS-SDLAELACVAVREEYRSGQRGDRLLNAISAQAKAEKINNLFVLTTRTAHWFMERGFSEADISA 417 ****7.689************************************************************ PP TIGR01890 408 lPearrklynyqrrskilvkkl 429 lP++r++lyn+qr+ski++k+l lcl|NCBI__GCF_000967895.1:WP_046010347.1 418 LPQERQSLYNFQRNSKIFIKEL 439 *******************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (429 nodes) Target sequences: 1 (440 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.86 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory