Align amino-acid N-acetyltransferase (EC 2.3.1.1) (characterized)
to candidate WP_046010620.1 OLEAN_RS19500 acetylglutamate kinase
Query= BRENDA::Q87EL2 (421 letters) >NCBI__GCF_000967895.1:WP_046010620.1 Length = 300 Score = 124 bits (311), Expect = 4e-33 Identities = 89/284 (31%), Positives = 141/284 (49%), Gaps = 24/284 (8%) Query: 6 EISQYLKRFSQLDAKRFAVVKVGGAVLRDDV--DALTSSLSFLQEVGLTPIVLHGAGPQL 63 E YL++FS + V+K GG + D+ ++ + L+ +G+ PIV+HG GPQ+ Sbjct: 17 EALPYLQKFSG----KTIVIKYGGNAMTDETLKNSFARDMVMLKLIGINPIVVHGGGPQI 72 Query: 64 DEELTAVGIQKKTVNGFRVTLPETMAIVRKVFHA-TNLQLIEALQRNGARATSITGG--- 119 E L + I+ + V+G RVT ETM +V V N ++ + +NG +A +TG Sbjct: 73 GEVLAKLNIKSEFVDGMRVTTSETMDVVEMVLGGLVNKDIVNLINQNGGKAIGLTGKDGQ 132 Query: 120 VFEAHYLDQETY------------GLVGGISAVNIAPIEASLRAASIPVIASLGETPSGQ 167 + A L G VG ++ VN ++ ++ IPVIA +G G Sbjct: 133 LLHAKKLQVTKQSPDMQQPEIIDIGHVGEVTRVNTQVLDMLSQSDFIPVIAPIGVDADGA 192 Query: 168 ILNINADVAANELVHVLQPYKIIFLTGTGGLLDADGKIINSINLSTEYEQLIQQPWVYGG 227 NINAD+ A ++ VL+ K+I LT GL D +G+++ + + E ++LI +YGG Sbjct: 193 SYNINADLVAGKVAEVLRAEKLILLTNISGLQDKNGEVLTGLT-TQEVDELIADGTIYGG 251 Query: 228 MKLKIEQIKHLLDRLPLESSVSITR-PADLAKELFTHKGSGTLI 270 M KI+ + + + R P ELFT +G GTLI Sbjct: 252 MLPKIQCALDAVHAGVTSAHIIDGRVPNATLLELFTDEGVGTLI 295 Lambda K H 0.320 0.136 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 300 Length adjustment: 29 Effective length of query: 392 Effective length of database: 271 Effective search space: 106232 Effective search space used: 106232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory