Align Shikimate kinase; SK; EC 2.7.1.71 (characterized)
to candidate WP_048061249.1 MTH_RS03785 shikimate kinase
Query= SwissProt::Q58835 (282 letters) >NCBI__GCF_000008645.1:WP_048061249.1 Length = 286 Score = 220 bits (560), Expect = 3e-62 Identities = 121/281 (43%), Positives = 184/281 (65%), Gaps = 15/281 (5%) Query: 10 SGTIINAIATGKGSAFGLDLKVYAKVKLIDDGKNKIEGKVLDNPNIKPNLIVRCVKNTLD 69 S T+INAIATG+GSAFG+ L+V A+ +LID G I + D +L+ C + ++ Sbjct: 10 SATVINAIATGRGSAFGIGLRVEAEAELIDSGVECISREGADT-----SLMELCTRMVIE 64 Query: 70 YFGLNYSAYVETKTEIPIKSGLSSSSATSNAVVLATFDALGEK-----IDDELILNLGIK 124 ++G++ V T +++P+ SGLSSSSA SNA V+A L ++ ++D +LN+ + Sbjct: 65 HYGVDAGVRVVTSSDLPVASGLSSSSAASNATVMAVSSLLSDEFGLQPMEDFEMLNMAVD 124 Query: 125 SSFDEKLTVTGAYDDATASYYGGITITDNIERKILKRDKMRDDLNVLILIPN---LEKNV 181 +S ++VTGAYDDA+AS+YGG+T+TDN+ER+I+ R+ M + VLI +P+ L Sbjct: 125 ASLQAGVSVTGAYDDASASFYGGLTVTDNMERRIILREPMENQ-KVLIYMPDRKSLTAQS 183 Query: 182 DVNRMKLIKDYVEIAFNEAINGNYFKALFLNGILYASALNFPTNIAIDALDAGAITAGLS 241 DV RMKL+ +V++AF E ++G AL LNGILY ++L F IA+DAL+AGA+ AGLS Sbjct: 184 DVPRMKLLAPWVDMAFREVLDGRVHSALTLNGILYCASLGFDPGIALDALEAGALAAGLS 243 Query: 242 GTGPSYIAMV-EDENVEKVKEKLNRYGKVILTKPNNDGASI 281 GTGPS++A+ ED + + N G V++T +N+G + Sbjct: 244 GTGPSFVALTHEDSEADIIDAWENLEGDVLVTSVDNEGTRV 284 Lambda K H 0.314 0.135 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 286 Length adjustment: 26 Effective length of query: 256 Effective length of database: 260 Effective search space: 66560 Effective search space used: 66560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
Align candidate WP_048061249.1 MTH_RS03785 (shikimate kinase)
to HMM TIGR01920 (shikimate kinase (EC 2.7.1.71))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01920.hmm # target sequence database: /tmp/gapView.25443.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01920 [M=266] Accession: TIGR01920 Description: Shik_kin_archae: shikimate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-82 262.4 0.8 2.4e-82 262.2 0.8 1.0 1 lcl|NCBI__GCF_000008645.1:WP_048061249.1 MTH_RS03785 shikimate kinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000008645.1:WP_048061249.1 MTH_RS03785 shikimate kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 262.2 0.8 2.4e-82 2.4e-82 2 266 .] 8 275 .. 7 275 .. 0.96 Alignments for each domain: == domain 1 score: 262.2 bits; conditional E-value: 2.4e-82 TIGR01920 2 sggitivnAlatGlGsAfgidLkveakvrlsdgeakvslkvreeeeldpelierilealieklgikegl 70 g+ t++nA+atG GsAfgi+L+vea+ +l+d ++v+ +re +d++l+e + +ie++g+ g+ lcl|NCBI__GCF_000008645.1:WP_048061249.1 8 PGSATVINAIATGRGSAFGIGLRVEAEAELID--SGVECISREG--ADTSLMELCTRMVIEHYGVDAGV 72 5899***************************9..7899999995..7********************** PP TIGR01920 71 eveveseiPagsGLksSsAlvnAlvlavlkakg.....eeiddieilrlgaelskeagvsvTGAfDDaa 134 v + s++P++sGL+sSsA++nA+v+av +++ + ++d+e+l++++ +s++agvsvTGA+DDa+ lcl|NCBI__GCF_000008645.1:WP_048061249.1 73 RVVTSSDLPVASGLSSSSAASNATVMAVSSLLSdefglQPMEDFEMLNMAVDASLQAGVSVTGAYDDAS 141 *******************************99444444589*************************** PP TIGR01920 135 asllggivltdNrkmkilkrdkleeetavvlvpkeeekeeevdlnelrkiskvveeavklAlkGeylkA 203 as++gg+++tdN +++i+ r+++e++++++ +p +++++++ d+ +++ ++ v+ a++ l G A lcl|NCBI__GCF_000008645.1:WP_048061249.1 142 ASFYGGLTVTDNMERRIILREPMENQKVLIYMPDRKSLTAQSDVPRMKLLAPWVDMAFREVLDGRVHSA 210 ********************************************************************* PP TIGR01920 204 mvlngvlyataLgyplepaekalekGAavaglsGkGPsyvalteepe.eevaealeea.geVivv 266 ++lng+ly++ Lg+++ +a +ale+GA++aglsG+GPs+valt+e+ ++ a+e+ g+V v+ lcl|NCBI__GCF_000008645.1:WP_048061249.1 211 LTLNGILYCASLGFDPGIALDALEAGALAAGLSGTGPSFVALTHEDSeADIIDAWENLeGDVLVT 275 *******************************************9998799************875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (266 nodes) Target sequences: 1 (286 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.86 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory