Align UPF0280 protein MA_1715 (characterized, see rationale)
to candidate WP_048186796.1 METBO_RS11705 UPF0280 family protein
Query= uniprot:Y1715_METAC (253 letters) >NCBI__GCF_000191585.1:WP_048186796.1 Length = 256 Score = 146 bits (368), Expect = 5e-40 Identities = 87/245 (35%), Positives = 142/245 (57%), Gaps = 20/245 (8%) Query: 18 KEHFQLRETIVTIAADDPAHIEAAKEAIRVHRATLETYILADPYFQFTLEPYECPEN--- 74 +E + ET + +++D + I R+ L+ YI+ +P F + EP E Sbjct: 3 EERITIGETELKVSSD--LMVPELSNYIISLRSQLKGYIMKNPEFLTSFEPLTVKETLDN 60 Query: 75 -----------APEVVRRMVKAGNTMGIGPMSAVAGTISALAVEAMVKAGAKYAIVDNGG 123 P +V M +AG +GPM+AVAGTIS L + MV+ GA + I+DNGG Sbjct: 61 KLSPDHGHTSEVPLIVNLMSRAGRRADVGPMAAVAGTISQLLMGFMVEKGANFIIIDNGG 120 Query: 124 DIALINDRSVVVGIYAGQSPIK-NLGLIFEPRDSITGVCTSAGTVGPSISFGMADAAAIF 182 DI+L ++ VVVG+YAG+S + LG +P+ + G+CTS+GTVG SISFG AD+ +F Sbjct: 121 DISLEINKDVVVGLYAGESSLSGELGFKIKPKQTPMGICTSSGTVGHSISFGRADSVTVF 180 Query: 183 SDDVSLADAAATALGNEVGIGK--EAVEVAFKVVKTV-QGIKGALVIQGEYIGMWGKVPK 239 +++ S+ADA AT++ NE K +AV+ + + + + ++G +V+ GE G G++P+ Sbjct: 181 ANEASIADALATSIANEAKGTKDEDAVQRSLEHAEEFKKAMRGVMVVVGESAGTLGRIPQ 240 Query: 240 ITRAE 244 + + + Sbjct: 241 LVQTD 245 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 253 Length of database: 256 Length adjustment: 24 Effective length of query: 229 Effective length of database: 232 Effective search space: 53128 Effective search space used: 53128 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory