Align Cystathionine gamma-synthase; CGS; O-succinylhomoserine (thiol)-lyase; EC 2.5.1.48 (characterized)
to candidate WP_049755415.1 AFER_RS07735 PLP-dependent transferase
Query= SwissProt::P9WGB7 (388 letters) >NCBI__GCF_000023265.1:WP_049755415.1 Length = 368 Score = 188 bits (478), Expect = 2e-52 Identities = 135/339 (39%), Positives = 187/339 (55%), Gaps = 30/339 (8%) Query: 56 YARTGNPTRAALEASLAAVEEGAFARAFSSGMAATDCALRAMLRPGDHVVIPDDAYGGTF 115 Y R NPT A EA + +E G A AF SG AAT L A+ G ++ D+Y GT Sbjct: 48 YGRHTNPTWEAFEALIGELEGGT-AVAFGSGAAATFALLLAL---GPRALVVADSYMGTR 103 Query: 116 RLIDKVFTRWDVQYTP----VRLADLDAVGAAITPRTRLIWVETPTNPLLSIADITAIAE 171 +L RW P V +DLDA + P + ++ +ETP+NPLL I +A+ Sbjct: 104 QL-----ARWLGARIPGIELVEPSDLDAHLDRLAPGS-VVLIETPSNPLLVTYPIATLAK 157 Query: 172 LGTDRSAKVLVDNTFASPALQQPLRLGADVVLHSTTKYIGGHSDVVGGALVTNDEELDEE 231 +R + VD+T A+P LQ+PL LGADVV+HS +K++ GHSDV+GG LV +DE+L Sbjct: 158 RIHERGGLLAVDSTLATPVLQRPLTLGADVVVHSASKFLSGHSDVLGGVLVASDEDLVAR 217 Query: 232 FAFLQNGAGAVPGPFDAYLTMRGLKTLVLRMQRHSENACAVAEFLADHPSVSSVLYPGLP 291 ++ GA+ GP +AYL RGL+TL +R++R S A +A L D +V YPG Sbjct: 218 VGEVRELTGAIIGPVEAYLCFRGLRTLAVRVERASATATTLAMRLRDRLG-DTVRYPGFD 276 Query: 292 SH---PGHEIAARQMRGFGGMVSVRMRAGRRAAQDLCAKTRVFILAESLGGVESLIEHPS 348 S PG RQ G +V++ + + ++A L + +F A SLGGVESL E Sbjct: 277 SELVGPG-----RQQSAGGALVALELESAQQADAMLDGLS-LFHHATSLGGVESLAERRG 330 Query: 349 AMTHASTAGSQLEVPDDLVRLSVGIEDIADLLGDLEQAL 387 G + LVRLSVG+ED+ DL GDL++AL Sbjct: 331 RYPGEDRIG------EGLVRLSVGLEDVEDLWGDLDRAL 363 Lambda K H 0.319 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 425 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 368 Length adjustment: 30 Effective length of query: 358 Effective length of database: 338 Effective search space: 121004 Effective search space used: 121004 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory